RBM47 Antibody

Immunohistochemistry-Paraffin: RBM47 Antibody [NBP1-83664] - Staining in human colon and skeletal muscle tissues using NBP1-83664 antibody. Corresponding RBM47 RNA-seq data are presented for the same tissues.

Western Blot: RBM47 Antibody [NBP1-83664] - Analysis in human cell lines A-549 and SK-MEL-30 using Anti-RBM47 antibody. Corresponding RBM47 RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1.

Immunocytochemistry/Immunofluorescence: RBM47 Antibody [NBP1-83664] - Staining of human cell line A549 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: RBM47 Antibody [NBP1-83664] - Staining of human colon shows strong nuclear positivity in glandular cells.

Western Blot: RBM47 Antibody [NBP1-83664] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: RBM47 Antibody [NBP1-83664] - Staining of human fallopian tube shows moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: RBM47 Antibody [NBP1-83664] - Staining of human kidney shows moderate nuclear positivity in cells in tubules.

Immunohistochemistry-Paraffin: RBM47 Antibody [NBP1-83664] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu, Rt, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

RBM47 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAARGGGAAEAAQQPSYVYSCDPYTLAYYGYPYNALIGPNRDYFVKAGSIRGRGRGAAGNRAPGPRGSYLGGYSAGRGIYSRYHEGKGKQQEKGYELVPNLEIPTVN
• Predicted Species: Mouse (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RBM47
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 24898756). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RBM47 Protein (NBP1-83664PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24898756).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RBM47 Antibody

• DKFZp686F02235
• FLJ20273
• FLJ21344
• FLJ21643
• NET18
• RNA binding motif protein 47
• RNA-binding motif protein 47
• RNA-binding protein 47

Background

The RBM47 gene encodes a RNA-binding protein 47 that in isoform 1 is 593 amino acid long, 64 kDA and in isoform 2 is 524 amino acid at 56 kDA. RBM47 interacts with genes ELAVL1 and ESR2. RBM47 is associated with intrahepatic cholangiocarcinoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RBM47 Antibody (NBP1-83664)(1)

Publication using NBP1-83664

• Vanharanta S, Marney CB, Shu W et al. Loss of the multifunctional RNA-binding protein RBM47 as a source of selectable metastatic traits in breast cancer. eLife 2014-06-04 [PMID: 24898756] (WB, Human)

Bioinformatics

• Gene Symbol: RBM47