RBM47 Antibody - BSA Free

Immunohistochemistry-Paraffin: RBM47 Antibody [NBP1-83664] - Staining in human colon and skeletal muscle tissues using NBP1-83664 antibody. Corresponding RBM47 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: RBM47 Antibody [NBP1-83664] - Staining of human cell line A549 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: RBM47 Antibody [NBP1-83664] - Staining of human colon shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: RBM47 Antibody [NBP1-83664] - Staining of human fallopian tube shows moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: RBM47 Antibody [NBP1-83664] - Staining of human kidney shows moderate nuclear positivity in cells in tubules.

Immunohistochemistry-Paraffin: RBM47 Antibody [NBP1-83664] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Analysis in human cell lines A-549 and SK-MEL-30 using Anti-RBM47 antibody. Corresponding RBM47 RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1.

• Reactivity: Hu, Rt, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RBM47 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RBM47 Antibody - BSA Free (NBP1-83664) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-RBM47 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAARGGGAAEAAQQPSYVYSCDPYTLAYYGYPYNALIGPNRDYFVKAGSIRGRGRGAAGNRAPGPRGSYLGGYSAGRGIYSRYHEGKGKQQEKGYELVPNLEIPTVN
• Predicted Species: Mouse (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RBM47
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RBM47 Protein (NBP1-83664PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RBM47 Antibody - BSA Free

• DKFZp686F02235
• FLJ20273
• FLJ21344
• FLJ21643
• NET18
• RNA binding motif protein 47
• RNA-binding motif protein 47
• RNA-binding protein 47

Background

The RBM47 gene encodes a RNA-binding protein 47 that in isoform 1 is 593 amino acid long, 64 kDA and in isoform 2 is 524 amino acid at 56 kDA. RBM47 interacts with genes ELAVL1 and ESR2. RBM47 is associated with intrahepatic cholangiocarcinoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RBM47 Antibody (NBP1-83664)(1)

Publication using NBP1-83664

• Vanharanta S, Marney CB, Shu W et al. Loss of the multifunctional RNA-binding protein RBM47 as a source of selectable metastatic traits in breast cancer. eLife 2014-06-04 [PMID: 24898756] (WB, Human)

Bioinformatics

• Gene Symbol: RBM47