RBM7 Antibody

Images

 
Western Blot: RBM7 Antibody [NBP1-86080] - Analysis in human cell line CAPAN-2.
Immunocytochemistry/ Immunofluorescence: RBM7 Antibody [NBP1-86080] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus.
Immunohistochemistry-Paraffin: RBM7 Antibody [NBP1-86080] - Staining of human colon shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RBM7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HEVSVPYAMNLLNGIKLYGRPIKIQFRSGSSHAPQDVSLSYPQHHVGNSSPTSTSPSSRYERTMDNMTSSAQIIQRSFSSPENFQRQAVMNSALRQMSYGGKFGSSPLDQSGFSPSVQSHSHSFNQSSSSQW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBM7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RBM7 Protein (NBP1-86080PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RBM7 Antibody

  • FLJ11153
  • RNA binding motif protein 7
  • RNA-binding motif protein 7
  • RNA-binding protein 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-79848
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00006428-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-94995
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-13729
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80669
Species: Hu
Applications: IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
AF6286
Species: Hu
Applications: WB, IHC
NBP1-88376
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-68135
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-89175
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46383
Species: Hu
Applications: WB, Flow, IHC
NBP1-86080
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RBM7 Antibody (NBP1-86080) (0)

There are no publications for RBM7 Antibody (NBP1-86080).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBM7 Antibody (NBP1-86080) (0)

There are no reviews for RBM7 Antibody (NBP1-86080). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RBM7 Antibody (NBP1-86080) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RBM7 Products

Bioinformatics Tool for RBM7 Antibody (NBP1-86080)

Discover related pathways, diseases and genes to RBM7 Antibody (NBP1-86080). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for RBM7 Antibody (NBP1-86080)

View related products by pathway.

Blogs on RBM7

There are no specific blogs for RBM7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBM7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RBM7