![Immunocytochemistry/Immunofluorescence: RBM7 Antibody [NBP1-86080] - Staining of human cell line U-251 MG shows localization to nucleus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/RBM7-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86080-img0014.jpg "Immunocytochemistry/Immunofluorescence: RBM7 Antibody [NBP1-86080] - Staining of human cell line U-251 MG shows localization to nucleus. Antibody staining is shown in green.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit RBM7 Antibody - BSA Free (NBP1-86080) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HEVSVPYAMNLLNGIKLYGRPIKIQFRSGSSHAPQDVSLSYPQHHVGNSSPTSTSPSSRYERTMDNMTSSAQIIQRSFSSPENFQRQAVMNSALRQMSYGGKFGSSPLDQSGFSPSVQSHSHSFNQSSSSQW |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RBM7 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Masahiro Hirata |
IHC-P | Human | 03/09/2021 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for RBM7 Antibody (NBP1-86080)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RBM7 |
![Immunohistochemistry-Paraffin: RBM7 Antibody [NBP1-86080] - Human prostate. Nuclei of glandular cells and smooth muscle were stained with NBP1-86080 at 1 ug/mL in 1%BSA for 30min, heat-induced antigen retrieval in a basic solution. Leica BOND polymer-based detection system. IHC-P image submitted by a verified customer review.](http://images.novusbio.com/fullsize/RBM7-Antibody-Immunohistochemistry-Paraffin-NBP1-86080-img0015.jpg "Immunohistochemistry-Paraffin: RBM7 Antibody [NBP1-86080] - Human prostate. Nuclei of glandular cells and smooth muscle were stained with NBP1-86080 at 1 ug/mL in 1%BSA for 30min, heat-induced antigen retrieval in a basic solution. Leica BOND polymer-based detection system. IHC-P image submitted by a verified customer review.")
![Immunohistochemistry-Paraffin: RBM7 Antibody [NBP1-86080] - Staining of human colon shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/RBM7-Antibody-Immunohistochemistry-Paraffin-NBP1-86080-img0009.jpg "Immunohistochemistry-Paraffin: RBM7 Antibody [NBP1-86080] - Staining of human colon shows moderate nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: RBM7 Antibody [NBP1-86080] - Staining of human endometrium shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/RBM7-Antibody-Immunohistochemistry-Paraffin-NBP1-86080-img0010.jpg "Immunohistochemistry-Paraffin: RBM7 Antibody [NBP1-86080] - Staining of human endometrium shows moderate nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: RBM7 Antibody [NBP1-86080] - Staining of human prostate shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/RBM7-Antibody-Immunohistochemistry-Paraffin-NBP1-86080-img0011.jpg "Immunohistochemistry-Paraffin: RBM7 Antibody [NBP1-86080] - Staining of human prostate shows moderate nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: RBM7 Antibody [NBP1-86080] - Staining of human skeletal muscle shows no nuclear positivity in striated muscle fibers as expected.](http://images.novusbio.com/fullsize/RBM7-Antibody-Immunohistochemistry-Paraffin-NBP1-86080-img0012.jpg "Immunohistochemistry-Paraffin: RBM7 Antibody [NBP1-86080] - Staining of human skeletal muscle shows no nuclear positivity in striated muscle fibers as expected.")
![DR3/TNFRSF25 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "DR3/TNFRSF25 [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
