RBM19 Antibody

Images

 
Western Blot: RBM19 Antibody [NBP2-88135] - Host: Rabbit. Target Name: RBM19. Sample Type: 293T Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RBM19 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human RBM19. Peptide sequence: KHAQKPSQPKQPPKDSTTPEIKKDEKKKKVAGQLEKLKEDTEFQEFLSVH The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
RBM19
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RBM19 Antibody

  • KIAA0682DKFZp586F1023
  • NPO
  • probable RNA-binding protein 19
  • RNA binding motif protein 19
  • RNA-binding motif protein 19

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
H00388112-B01P
Species: Hu
Applications: WB
NB110-61646
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
AF1997
Species: Hu
Applications: ChIP, ICC, IHC, WB
NB600-241
Species: Hu, Mu, Pl, Rt
Applications: ChIP, EM, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IM, KD, Simple Western, WB
NBP3-05567
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-24583
Species: Bv, Eq, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC, IHC-P, WB
NBP1-83237
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF4509
Species: Hu
Applications: ICC, WB
NBP2-88135
Species: Hu
Applications: WB

Publications for RBM19 Antibody (NBP2-88135) (0)

There are no publications for RBM19 Antibody (NBP2-88135).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBM19 Antibody (NBP2-88135) (0)

There are no reviews for RBM19 Antibody (NBP2-88135). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RBM19 Antibody (NBP2-88135) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RBM19 Products

Bioinformatics Tool for RBM19 Antibody (NBP2-88135)

Discover related pathways, diseases and genes to RBM19 Antibody (NBP2-88135). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBM19 Antibody (NBP2-88135)

Discover more about diseases related to RBM19 Antibody (NBP2-88135).
 

Pathways for RBM19 Antibody (NBP2-88135)

View related products by pathway.

Blogs on RBM19

There are no specific blogs for RBM19, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBM19 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RBM19