Recombinant Human RBM12B Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RBM12B Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 765 of Human RBM12B full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAVVIRLLGLPFIAGPVDIRHFFTGLTIPDGGVHIIGGEIGEAFIIFATDEDARRAISRSGGFIKDSSVELFLSSKAEMQKTIEMKRTDRVGRGRPGSGTSGVDSLSNFIESVKEEASNSGYGSSINQDAGFHTNGTGHGNLRPRKTRPLKAENPYLFLRGLPYLVNEDDVRVFFSGLCVDGVIFLKHHDGRNNGDAIVKFASCVDASGGLKCHRSFMGSRFIEVMQGSEQQWIEFGGNAVKEGDVLRRFEEHSPPRGINDRHFRKRSHSKSPRRTRSRSPLGFYVHLKNLSLSIDERDLRNFFRGTDLTDEQIRFLYKDENRTRYAFVMFKTLKDYNTALSLHKTVLQYRPVHIDPISRKQMLKFIARYEKKRSGSLERDRPGHVSQKYSQEGNSGQKLCIYIRNFPFDVTKVEVQKFFADFLLAEDDIYLLYDDKGVGLGEALVKFKSEEQAMKAERLNRRRFLGTEVLLRLISEAQIQEFGVNFSVMSSEKMQARSQSRERGDHSHLFDSKDPPIYSVGAFENFRHQLEDLRQLDNFKHPQRDFRQPDRHPPEDFRHSSEDFRFPPEDFRHSPEDFRRPREEDFRRPSEEDFRRPWEEDFRCPPEDDFRHPREEDWRRPPPEHFGGLPQSTSGGHPQSTSGGHPQSISGARPRSTSGDRPRSISGGHLRSISGAPERKISGTHQMKTSGALLMKTLGTLLMRTSGAPRRKILDALLMRTSGSSQRKTLGKLRRRTLDFLTILDLLVRILGARLMILEVTALL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
RBM12B
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RBM12B Protein

  • MGC:33837
  • RNA binding motif protein 12B
  • RNA-binding motif protein 12B
  • RNA-binding protein 12B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-2383
Species: Hu
Applications: WB, ICC/IF
NBP2-02272
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NBP1-76802
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF6108
Species: Hu
Applications: IHC
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NB100-834
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
MAB864
Species: Hu, Mu, Rt
Applications: WB, ICC
H00011266-D01P
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB4104
Species: Hu
Applications: WB, IP, Neut
AF4877
Species: Hu
Applications: WB
NBP1-76949
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P

Publications for RBM12B Recombinant Protein (H00389677-P01) (0)

There are no publications for RBM12B Recombinant Protein (H00389677-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBM12B Recombinant Protein (H00389677-P01) (0)

There are no reviews for RBM12B Recombinant Protein (H00389677-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RBM12B Recombinant Protein (H00389677-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RBM12B Products

Bioinformatics Tool for RBM12B Recombinant Protein (H00389677-P01)

Discover related pathways, diseases and genes to RBM12B Recombinant Protein (H00389677-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBM12B Recombinant Protein (H00389677-P01)

Discover more about diseases related to RBM12B Recombinant Protein (H00389677-P01).
 

Pathways for RBM12B Recombinant Protein (H00389677-P01)

View related products by pathway.

Blogs on RBM12B

There are no specific blogs for RBM12B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RBM12B Antibody
NBP1-85981

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RBM12B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RBM12B