RB1CC1 Antibody

Images

 
Immunohistochemistry-Paraffin: RB1CC1 Antibody [NBP2-48572] - Staining of human testis shows cytoplasmic positivity.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RB1CC1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MKAIKGLEDRLYALDQMIASCGRLVNEQKELAQGFLANQKRAENLKDASVLPDLCLSHANQLMIMLQNHRKLLDIKQKCTTAKQELANNLHVRLKWCCFV
Specificity
Specificity of human RB1CC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RB1CC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RB1CC1 Recombinant Protein Antigen (NBP2-48572PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RB1CC1 Antibody

  • CC1
  • DRAGOU14
  • FIP200
  • KIAA0203200 kDa FAK family kinase-interacting protein
  • RB1-inducible coiled-coil 1
  • RB1-inducible coiled-coil protein 1
  • RBICC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
NBP2-24738
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP2-67327
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-2688
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-CS
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-90014
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2244
Species: Hu
Applications: WB, IHC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-04014
Species: Hu
Applications: WB, IP
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-48320
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-32463
Species: Hu
Applications: IHC, IHC-P
NBP2-52419
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
MAB4379
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP2-48572
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for RB1CC1 Antibody (NBP2-48572) (0)

There are no publications for RB1CC1 Antibody (NBP2-48572).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RB1CC1 Antibody (NBP2-48572) (0)

There are no reviews for RB1CC1 Antibody (NBP2-48572). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RB1CC1 Antibody (NBP2-48572) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RB1CC1 Antibody (NBP2-48572)

Discover related pathways, diseases and genes to RB1CC1 Antibody (NBP2-48572). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RB1CC1 Antibody (NBP2-48572)

Discover more about diseases related to RB1CC1 Antibody (NBP2-48572).
 

Pathways for RB1CC1 Antibody (NBP2-48572)

View related products by pathway.

PTMs for RB1CC1 Antibody (NBP2-48572)

Learn more about PTMs related to RB1CC1 Antibody (NBP2-48572).
 

Research Areas for RB1CC1 Antibody (NBP2-48572)

Find related products by research area.

Blogs on RB1CC1.

Autophagy independent roles of the core ATG proteins
By Christina Towers, PhD. Autophagy and ATG ProteinsAutophagy is a nutrient recycling process that cells use to fuel metabolism, particularly in response to nutrient deprivation.  It is critical for removal of dam...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RB1CC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RB1CC1