RB associated KRAB repressor Antibody - BSA Free

Western Blot: RB associated KRAB repressor Antibody [NBP2-85608] - WB Suggested Anti-RBAK Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: HepG2 cell lysate

Immunohistochemistry: RB associated KRAB repressor Antibody [NBP2-85608] - Human kidney

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RB associated KRAB repressor Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RB associated KRAB repressor Antibody - BSA Free (NBP2-85608) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RB associated KRAB repressor. Peptide sequence: HYRSHLEEKPYECNECGKTFNLNSAFIRHRKVHTEEKSHECSECGKFSQL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RBAK
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RB associated KRAB repressor Antibody - BSA Free

• hRBaK
• RB-associated KRAB repressor
• RB-associated KRAB zinc finger protein
• RB-associated KRAB zinc finger
• ZNF769Zinc finger protein 769

Background

RB associated KRAB repressor, also known as ZNF769, consists of a 83 kDa 714 and a shorter 12 kDa 113 isoform. Its function is to promote AR-dependent transcription by encoding a nuclear protein. Current research on RB associated KRAB repressor is being conducted in its relationship to retinoblastoma, hyperaldosteronism and familial hyperaldosteronism. RB associated KRAB repressor is known to interact with SUMO1, RB1, AR and SMARCAD1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RBAK