RASSF6 Antibody

Images

 
Western Blot: RASSF6 Antibody [NBP1-68973] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RASSF6 Antibody Summary

Immunogen
Synthetic peptides corresponding to RASSF6 (Ras association (RalGDS/AF-6) domain family member 6) The peptide sequence was selected from the middle region of RASSF6. Peptide sequence FDDLYRISELDRTQIPMSEKRNSQEDYLSYHSNTLKPHAKDEPDSPVLYR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RASSF6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against RASSF6 and was validated on Western blot.
Theoretical MW
41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RASSF6 Antibody

  • DKFZp686K23225
  • putative RAS binding protein
  • Ras association (RalGDS/AF-6) domain family 6
  • Ras association (RalGDS/AF-6) domain family member 6
  • ras association domain-containing protein 6

Background

RASSF6 is a member of the RAS association (RA) domain family of RAS effectors/tumor suppressors that mediate some of the growth inhibitory properties of RAS (see HRAS; MIM 190020) oncogenes (Eckfeld et al., 2004 [PubMed 15574778]).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB500-248
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89425
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89249
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20163
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5639
Species: Hu, Mu
Applications: WB, ICC
NBP1-48017
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
H00060485-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00006789-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, PLA
NBP2-30584
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NBP1-87833
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58860
Species: Hu
Applications: ICC/IF
NBP1-68973
Species: Hu
Applications: WB

Publications for RASSF6 Antibody (NBP1-68973) (0)

There are no publications for RASSF6 Antibody (NBP1-68973).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RASSF6 Antibody (NBP1-68973) (0)

There are no reviews for RASSF6 Antibody (NBP1-68973). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RASSF6 Antibody (NBP1-68973) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RASSF6 Products

Bioinformatics Tool for RASSF6 Antibody (NBP1-68973)

Discover related pathways, diseases and genes to RASSF6 Antibody (NBP1-68973). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RASSF6 Antibody (NBP1-68973)

Discover more about diseases related to RASSF6 Antibody (NBP1-68973).
 

Pathways for RASSF6 Antibody (NBP1-68973)

View related products by pathway.

PTMs for RASSF6 Antibody (NBP1-68973)

Learn more about PTMs related to RASSF6 Antibody (NBP1-68973).

Blogs on RASSF6

There are no specific blogs for RASSF6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RASSF6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RASSF6
Uniprot