RASSF3 Antibody (3A5) - Azide and BSA Free

Western Blot: RASSF3 Antibody (3A5) [H00283349-M15] - Analysis of RASSF3 expression in human placenta.

Immunocytochemistry/Immunofluorescence: RASSF3 Antibody (3A5) [H00283349-M15] - Analysis of monoclonal antibody to RASSF3 on HeLa cell. Antibody concentration 10 ug/ml

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 3A5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RASSF3 Antibody (3A5) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse RASSF3 Antibody (3A5) - Azide and BSA Free (H00283349-M15) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. Anti-RASSF3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: RASSF3 (NP_835463.1, 29 a.a. ~ 112 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QGKPRSGQQDVEKEKETHSYLSKEEIKEKVHKYNLAVTDKLKMTLNSNGIYTGFIKVQMELCKPPQTSPNSGKLSPSSNGCMNT
• Specificity: RASSF3 - Ras association (RalGDS/AF-6) domain family 3 (3A5)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RASSF3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RASSF3 Antibody (3A5) - Azide and BSA Free

• MGC119194
• MGC119195
• MGC119197
• Ras association (RalGDS/AF-6) domain family 3
• Ras association (RalGDS/AF-6) domain family member 3
• ras association domain-containing protein 3
• RASSF5

Background

The RAS oncogene (MIM 190020) is mutated in nearly one-third of all human cancers. Members of the RAS superfamily are plasma membrane GTP-binding proteins that modulate intracellular signal transduction pathways. A subfamily of RAS effectors, including RASSF3, share a RAS association (RA) domain.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RASSF3 Antibody (H00283349-M15)(1)

Publication using H00283349-M15

• Sallee JL, Burridge K. Density-enhanced Phosphatase 1 Regulates Phosphorylation of Tight Junction Proteins Enhances Barrier Function of Epithelial Cells. J Biol Chem;284(22):14997-15006. 2009-01-01 [PMID: 19332538]

Bioinformatics

• Gene Symbol: RASSF3
• Entrez:
  • 283349(Human)
• Uniprot:
  • NP_835463(Human)