RASSF1 Recombinant Protein Antigen

Images

 
There are currently no images for RASSF1 Protein (NBP1-89411PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RASSF1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RASSF1.

Source: E. coli

Amino Acid Sequence: KFTCHYRCRALVCLDCCGPRDLGWEPAVERDTNVDEPVEWETPDLSQAEIEQKIKEYNAQINSNLFMSLNKDG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RASSF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89411.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RASSF1 Recombinant Protein Antigen

  • 123F2
  • NORE2A
  • pancreas-specific ras association domain family 1 protein
  • Ras association (RalGDS/AF-6) domain family member 1
  • ras association domain-containing protein 1
  • RASSF1A
  • RDA32cardiac-specific ras association domain family 1 protein
  • REH3P21
  • tumor suppressor protein RDA32
  • WUGSC:H_LUCA12.5

Background

The tumor suppressor gene RASSF1A (3p21.3), human Ras association domain family 1A, is expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, small intestine, colon, and peripheral blood leukocytes. RASSF1A expression is inhibited by hypermethylation of the CpG island including the promoter and early transcribed regions of the human RASSF1A gene. Hypermethylated RASSF1A promoter is observed in primary tumors. Furthermore, RASSF1A is related with cell cycle regulation, apoptosis and microtubule stability. Agathanggelou A. et al

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF4885
Species: Mu
Applications: IP, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
NB100-168
Species: Hu, Mu(-)
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NB200-323
Species: Hu, Rt
Applications: WB
352-MS
Species: Hu
Applications: BA
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP3-21649
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-73041
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, WB
NBP2-02450
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-92025
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00084000-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-15840
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-67381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, KO, WB
AF3264
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-82454
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-31528
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-89411PEP
Species: Hu
Applications: AC

Publications for RASSF1 Protein (NBP1-89411PEP) (0)

There are no publications for RASSF1 Protein (NBP1-89411PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RASSF1 Protein (NBP1-89411PEP) (0)

There are no reviews for RASSF1 Protein (NBP1-89411PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RASSF1 Protein (NBP1-89411PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RASSF1 Products

Research Areas for RASSF1 Protein (NBP1-89411PEP)

Find related products by research area.

Blogs on RASSF1.

The role of DNMT3B in the co-incidence of methyltransferase and tumor suppressor expression in malignancies
Epigenetics is the process of heritable change in gene activity despite alteration of the hosts DNA sequence, essentially causing a change in a phenotype without a change in the genotype of a host. To change the gene sequence without interfering w...  Read full blog post.

Role of RASSF1A in Death Receptor-Dependent Apoptosis
Death-receptor apoptosis, or cell death, is essential for cellular growth regulation; its disruption is expressed in a variety of cancers. We at Novus Biologicals are one of the leading antibody suppliersfor apoptosis and cancer research groups, and t...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RASSF1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RASSF1