RASA3 Antibody (1F11) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse RASA3 Antibody (1F11) - Azide and BSA Free (H00022821-M01) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
RASA3 (AAH47242, 725 a.a. ~ 834 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DGDRETERIYSLFNLYMSKLEKMQEACGSKSVYDGPEQEEYSTFVIDDPQETYKTLKQVIAGVGALEQEHAQYKRDKFKKTKYGSQEHPIGDKSFQNYIRQQSETSTHSI |
| Specificity |
RASA3 - RAS p21 protein activator 3 |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
RASA3 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot 1:500
|
| Application Notes |
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for RASA3 Antibody (1F11) - Azide and BSA Free
Background
The protein encoded by this gene is member of the GAP1 family of GTPase-activating proteins. The gene product stimulates the GTPase activity of normal RAS p21 but not its oncogenic counterpart. Acting as a suppressor of RAS function, the protein enhances the weak intrinsic GTPase activity of RAS proteins resulting in the inactive GDP-bound form of RAS, thereby allowing control of cellular proliferation and differentiation. This family member is an inositol 1,3,4,5-tetrakisphosphate-binding protein, like the closely related RAS p21 protein activator 2. The two family members have distinct pleckstrin-homology domains, with this particular member having a domain consistent with its localization to the plasma membrane.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
Species: Hu, Pm
Applications: ICC/IF, KD, PLA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Publications for RASA3 Antibody (H00022821-M01) (0)
There are no publications for RASA3 Antibody (H00022821-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RASA3 Antibody (H00022821-M01) (0)
There are no reviews for RASA3 Antibody (H00022821-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for RASA3 Antibody (H00022821-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RASA3 Products
Research Areas for RASA3 Antibody (H00022821-M01)
Find related products by research area.
|
Blogs on RASA3