Recombinant Human RAPGEF2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RAPGEF2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1398-1487 of Human RAPGEF2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PITDFPEGHSHPARKPPDYNVALQRSRMVARSSDTAGPSSVQQPHGHPTSSRPVNKPQWHKPNESDPRLAPYQSQGFSTEEDEDEQVSAV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RAPGEF2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RAPGEF2 Protein

  • CNrasGEF
  • KIAA0313
  • Neural RAP guanine nucleotide exchange protein
  • nRap GEP
  • NRAPGEP
  • PDZ domain containing guanine nucleotide exchange factor (GEF) 1
  • PDZGEF1
  • PDZ-GEF1PDZ domain-containing guanine nucleotide exchange factor 1
  • RA(Ras/Rap1A-associating)-GEF
  • RA-GEFDKFZP586O1422
  • Rap guanine nucleotide exchange factor (GEF) 2
  • rap guanine nucleotide exchange factor 2
  • Rap-GEP

Background

RAPGEF2 - Rap guanine nucleotide exchange factor (GEF) 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-24574
Species: Hu, Mu, Ca, Ch, Eq, Op, Pm, Xp
Applications: WB, IHC-P
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6260
Species: Hu
Applications: WB
H00009771-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
H00010411-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
H00051735-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
NBP2-45528
Species: Hu
Applications: WB, IHC
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF7117
Species: Hu, Mu
Applications: WB, IHC, ICC

Publications for RAPGEF2 Partial Recombinant Protein (H00009693-Q01) (0)

There are no publications for RAPGEF2 Partial Recombinant Protein (H00009693-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAPGEF2 Partial Recombinant Protein (H00009693-Q01) (0)

There are no reviews for RAPGEF2 Partial Recombinant Protein (H00009693-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAPGEF2 Partial Recombinant Protein (H00009693-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RAPGEF2 Products

Bioinformatics Tool for RAPGEF2 Partial Recombinant Protein (H00009693-Q01)

Discover related pathways, diseases and genes to RAPGEF2 Partial Recombinant Protein (H00009693-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAPGEF2 Partial Recombinant Protein (H00009693-Q01)

Discover more about diseases related to RAPGEF2 Partial Recombinant Protein (H00009693-Q01).
 

Pathways for RAPGEF2 Partial Recombinant Protein (H00009693-Q01)

View related products by pathway.

PTMs for RAPGEF2 Partial Recombinant Protein (H00009693-Q01)

Learn more about PTMs related to RAPGEF2 Partial Recombinant Protein (H00009693-Q01).
 

Research Areas for RAPGEF2 Partial Recombinant Protein (H00009693-Q01)

Find related products by research area.

Blogs on RAPGEF2

There are no specific blogs for RAPGEF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RAPGEF2 Antibody
NBP1-06549

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RAPGEF2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RAPGEF2