RAMP2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: RAMP2 Antibody [NBP2-58104] - Staining of human cell line SH-SY5Y shows localization to vesicles.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RAMP2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RAMP2 Antibody - BSA Free (NBP2-58104) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PLPTTGTPGSEGGTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RAMP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RAMP2 Recombinant Protein Antigen (NBP2-58104PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RAMP2 Antibody - BSA Free

• calcitonin receptor-like receptor activity modifying protein 2
• Calcitonin-receptor-like receptor activity-modifying protein 2
• CRLR activity-modifying protein 2
• RAMP2
• receptor (calcitonin) activity modifying protein 2
• receptor (G protein-coupled) activity modifying protein 2
• receptor activity modifying protein 2
• receptor activity-modifying protein 2
• receptor-activity-modifying protein 2

Background

The protein encoded by the RAMP2 gene is a member of the RAMP family of single-transmembrane-domain proteins, called receptor (calcitonin) activity modifying proteins (RAMPs). RAMPs are type I transmembrane proteins with an extracellular N terminus and a cytoplasmic C terminus. RAMPs are required to transport calcitonin-receptor-like receptor (CRLR) to the plasma membrane. CRLR, a receptor with seven transmembrane domains, can function as either a calcitonin-gene-related peptide (CGRP) receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. In the presence of this (RAMP2) protein, CRLR functions as an adrenomedullin receptor. The RAMP2 protein is involved in core glycosylation and transportation of adrenomedullin receptor to the cell surface.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RAMP2