RAGEF2 Antibody (2C5) [DyLight 488] Summary
| Immunogen |
RAPGEF6 (NP_057424, 1012 a.a. ~ 1111 a.a) partial recombinant protein with GST tag.LFPVVKKDMTFLHEGNDSKVDGLVNFEKLRMISKEIRQVVRM
TSANMDPAMMFRQRSLSQGSTNSNMLDVQGGAHKKRARRSSL
LNAKKLYEDAQMARK |
| Specificity |
RAPGEF6 - Rap guanine nucleotide exchange factor (GEF) 6 |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
RAPGEF6 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot
|
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
| Storage |
Store at 4C in the dark. |
| Buffer |
50mM Sodium Borate |
| Preservative |
0.05% Sodium Azide |
| Purity |
IgG purified |
Notes
Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for RAGEF2 Antibody (2C5) [DyLight 488]
Background
Low similarity to human CAMP-GEFII; may be a membrane signalling protein; contains a PDZ, a cyclic nucleotide-binding, and a RasGEF domain.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Pm
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Ca, Ch, Eq, Hu, Mu, Ma-Op, Pm, Xp
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, S-ELISA, WB
Species: Hu, Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
Publications for RAGEF2 Antibody (H00051735-M01G) (0)
There are no publications for RAGEF2 Antibody (H00051735-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RAGEF2 Antibody (H00051735-M01G) (0)
There are no reviews for RAGEF2 Antibody (H00051735-M01G).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for RAGEF2 Antibody (H00051735-M01G) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RAGEF2 Products
Research Areas for RAGEF2 Antibody (H00051735-M01G)
Find related products by research area.
|
Blogs on RAGEF2