RAGEF2 Antibody (2C5) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related RAGEF2 Primary Antibodies

Order Details


    • Catalog Number
      H00051735-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RAGEF2 Antibody (2C5) [DyLight 488] Summary

Immunogen
RAPGEF6 (NP_057424, 1012 a.a. ~ 1111 a.a) partial recombinant protein with GST tag.LFPVVKKDMTFLHEGNDSKVDGLVNFEKLRMISKEIRQVVRM TSANMDPAMMFRQRSLSQGSTNSNMLDVQGGAHKKRARRSSL LNAKKLYEDAQMARK
Specificity
RAPGEF6 - Rap guanine nucleotide exchange factor (GEF) 6
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RAPGEF6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAGEF2 Antibody (2C5) [DyLight 488]

  • DKFZp667N084
  • DKFZp686I15116
  • KIA001LB
  • PDZ domain-containing guanine nucleotide exchange factor 2
  • PDZ domain-containing guanine nucleotide exchange factor I
  • PDZ-GEF2RA-GEF-2PDZGEF2PDZ domain containing guanine nucleotide exchange factor (GEF) 2
  • RAGEF2
  • Rap guanine nucleotide exchange factor (GEF) 6
  • rap guanine nucleotide exchange factor 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-06549
Species: Hu, Mu
Applications: IP (-), WB, IHC-P
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC-P, IP
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56139
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-89269
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-82131
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24574
Species: Hu, Mu, Ca, Ch, Eq, Op, Pm, Xp
Applications: WB, IHC-P
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
AF1103
Species: Hu
Applications: WB, IHC, ICC
NBP1-81039
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20072
Species: Hu
Applications: WB, IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
H00051735-M01G
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for RAGEF2 Antibody (H00051735-M01G) (0)

There are no publications for RAGEF2 Antibody (H00051735-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAGEF2 Antibody (H00051735-M01G) (0)

There are no reviews for RAGEF2 Antibody (H00051735-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RAGEF2 Antibody (H00051735-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAGEF2 Products

Bioinformatics Tool for RAGEF2 Antibody (H00051735-M01G)

Discover related pathways, diseases and genes to RAGEF2 Antibody (H00051735-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAGEF2 Antibody (H00051735-M01G)

Discover more about diseases related to RAGEF2 Antibody (H00051735-M01G).
 

Pathways for RAGEF2 Antibody (H00051735-M01G)

View related products by pathway.

Research Areas for RAGEF2 Antibody (H00051735-M01G)

Find related products by research area.

Blogs on RAGEF2

There are no specific blogs for RAGEF2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAGEF2 Antibody (2C5) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol RAPGEF6