RAD21L1 Antibody

Images

 
Immunohistochemistry-Paraffin: RAD21L1 Antibody [NBP2-14779] - Staining of human ovary shows distinct positivity in erythrocytes.
Immunohistochemistry-Paraffin: RAD21L1 Antibody [NBP2-14779] - Staining of human testis shows strong nuclear positivity.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAD21L1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: KRGGVHTLLSTAAQDLIHAELKMLFTKCFLSSGFKLGRKMIQKESVREEVGNQNIVETSMMQEPNYQQELSKPQTWKDVIG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAD21L1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RAD21L1 Protein (NBP2-14779PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RAD21L1 Antibody

  • dJ545L17.2
  • RAD21L
  • RAD21L1 RAD21-like 1 (S. pombe)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20053
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
NBP1-87145
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38851
Species: Hu
Applications: IHC, IHC-P
NB100-207
Species: Ce, Hu, Mu
Applications: IHC, IHC-P, IP, WB
AF4928
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP1-89966
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00004438-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-48291
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
MAB1934
Species: Hu
Applications: CyTOF-ready, Flow, IP, WB
NBP2-67381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP1-80118
Species: Hu
Applications: IHC, IHC-P, WB
NB100-204
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
H00009700-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-14779
Species: Hu
Applications: IHC

Publications for RAD21L1 Antibody (NBP2-14779) (0)

There are no publications for RAD21L1 Antibody (NBP2-14779).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAD21L1 Antibody (NBP2-14779) (0)

There are no reviews for RAD21L1 Antibody (NBP2-14779). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RAD21L1 Antibody (NBP2-14779) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAD21L1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAD21L1