![Immunocytochemistry/Immunofluorescence: RAB42 Antibody (3A2) [H00115273-M03] - Analysis of monoclonal antibody to RAB42 on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/fullsize/RAB42-Antibody-3A2-Immunocytochemistry-Immunofluorescence-H00115273-M03-img0002.jpg "Immunocytochemistry/Immunofluorescence: RAB42 Antibody (3A2) [H00115273-M03] - Analysis of monoclonal antibody to RAB42 on HeLa cell. Antibody concentration 10 ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clone | 3A2 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse RAB42 Antibody (3A2) - Azide and BSA Free (H00115273-M03) is a monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. Anti-RAB42 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | RAB42 (NP_689517, 46 a.a. ~ 105 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SVKNNCNVDLAFDTLADAIQQALQQGDIKLEEGWGGVRLIHKTQIPRSPSRKQHSGPCQC |
| Specificity | RAB42 - RAB42, member RAS homolog family |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | RAB42 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Publication using H00115273-M03 | Applications | Species |
|---|---|---|
| Sun L, Yan T, Yang B The Progression Related Gene RAB42 Affects the Prognosis of Glioblastoma Patients Brain sciences 2022-06-11 [PMID: 35741652] (WB, Human) | WB | Human |
| Images | Ratings | Applications | Species | Date | Details | ||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Verified Customer |
WB | Human | 09/08/2015 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for RAB42 Antibody (H00115273-M03)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: RAB42 Antibody (3A2) [H00115273-M03] - Analysis of monoclonal antibody to RAB42 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml](http://images.novusbio.com/fullsize/RAB42-Antibody-3A2-Immunohistochemistry-Paraffin-H00115273-M03-img0003.jpg "Immunohistochemistry-Paraffin: RAB42 Antibody (3A2) [H00115273-M03] - Analysis of monoclonal antibody to RAB42 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml")
![Neutralization CX3CL1/Fractalkine Antibody [Unconjugated]](https://images.novusbio.com/images2/CX3CL1_AF365_Block_Neutralize_8860.jpg)
![Western Blot CX3CL1/Fractalkine Antibody [Unconjugated]](https://images.novusbio.com/images/af365_human-cx3cl1-fractalkine-affinity-purified-polyclonal-ab-8120255552865.jpg)
![Immunohistochemistry FGF acidic/FGF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/FGF_acidic_AF232_Immunohistochemistry_17183.jpg)
![Simple Western FGF acidic/FGF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/FGF_acidic_AF232_Simple_Western_17471.jpg)
![Western Blot FGF acidic/FGF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/FGF_acidic_AF232_Western_Blot_18640.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A ST2/IL-33R [Biotin]](https://images.novusbio.com/images2/DATA_ST2_DY523_ELISA_2475.jpg)
![N/A ST2/IL-33R [Biotin]](https://images.novusbio.com/images2/DATA_ST2_DY523_ELISA_2088.jpg)
![SEC-MALS IL-7 [Unconjugated]](https://images.novusbio.com/images/207-il_recombinant-human-il-7-protein-sec-mals-123202493447..jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")