RAB42 Antibody (3A2) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: RAB42 Antibody (3A2) [H00115273-M03] - Analysis of monoclonal antibody to RAB42 on HeLa cell. Antibody concentration 10 ug/ml

Immunohistochemistry-Paraffin: RAB42 Antibody (3A2) [H00115273-M03] - Analysis of monoclonal antibody to RAB42 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml

The RAB42 expression levels in local GBM cells and specmens. (A,B) RAB42 mRNA expression and protein expression were both upregulated in GBM cell lines, respectively (vs. HA1800; * p <0.05, ** p < 0.01, *** p < 0.001). Image collected and cropped by CiteAb from the following open publication (//pubmed.ncbi.nlm.nih.gov/35741652), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 3A2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RAB42 Antibody (3A2) - Azide and BSA Free Summary

• Immunogen: RAB42 (NP_689517, 46 a.a. ~ 105 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SVKNNCNVDLAFDTLADAIQQALQQGDIKLEEGWGGVRLIHKTQIPRSPSRKQHSGPCQC
• Specificity: RAB42 - RAB42, member RAS homolog family
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RAB42
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAB42 Antibody (3A2) - Azide and BSA Free

• MGC45806
• putative Ras-related protein Rab-42
• RAB42, member RAS homolog family
• RAB42, member RAS oncogene family
• RP4-669K10.6

Background

Belongs to the small GTPase superfamily. Rab family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RAB42 Antibody (H00115273-M03)(1)

Publication using H00115273-M03

• Sun L, Yan T, Yang B The Progression Related Gene RAB42 Affects the Prognosis of Glioblastoma Patients Brain sciences 2022-06-11 [PMID: 35741652] (WB, Human)

Review for RAB42 Antibody (H00115273-M03) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer WB Human 09/08/2015

Summary

• Application: Western Blot
• Sample Tested: Human cancer cell
• Species: Human

Bioinformatics

• Gene Symbol: RAB42
• Entrez:
  • 115273(Human)
• Uniprot:
  • NP_689517(Human)