Rab3D Antibody

Images

 
Western Blot: Rab3D Antibody [NBP2-56973] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: Rab3D Antibody [NBP2-56973] - Staining of human cell line MCF7 shows localization to vesicles. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Rab3D Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSSCSC
Specificity
Specificity of human Rab3D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAB3D
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Rab3D Recombinant Protein Antigen (NBP2-56973PEP)

Reactivity Notes

Mouse 86%, Rat 83%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Rab3D Antibody

  • D2-2
  • GOVras-related protein Rab-3D
  • RAB16glioblastoma overexpressed
  • RAB3D, member RAS oncogene family
  • RAD3DRab3D upregulated with myeloid differentiation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45499
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32871
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005865-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
H00005873-M02
Species: Hu, Mu, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RNAi, S-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt, Pl
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC, KD
NBP2-62664
Species: Hu
Applications: IHC, IHC-P
MAB4218
Species: Hu
Applications: WB, IHC
NB120-13253
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-89538
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84954
Species: Hu
Applications: IHC, IHC-P
NBP1-87940
Species: Hu
Applications: IHC, IHC-P
AF1445
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB300-595
Species: Mu, Rt, Bv, Pm
Applications: WB, Flow, IHC, IHC-P, IP, IF
NBP2-37485
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready

Publications for Rab3D Antibody (NBP2-56973) (0)

There are no publications for Rab3D Antibody (NBP2-56973).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rab3D Antibody (NBP2-56973) (0)

There are no reviews for Rab3D Antibody (NBP2-56973). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Rab3D Antibody (NBP2-56973) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Rab3D Products

Bioinformatics Tool for Rab3D Antibody (NBP2-56973)

Discover related pathways, diseases and genes to Rab3D Antibody (NBP2-56973). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rab3D Antibody (NBP2-56973)

Discover more about diseases related to Rab3D Antibody (NBP2-56973).
 

Pathways for Rab3D Antibody (NBP2-56973)

View related products by pathway.

PTMs for Rab3D Antibody (NBP2-56973)

Learn more about PTMs related to Rab3D Antibody (NBP2-56973).
 

Research Areas for Rab3D Antibody (NBP2-56973)

Find related products by research area.

Blogs on Rab3D

There are no specific blogs for Rab3D, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Rab3D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB3D