RAB3B Antibody (3F12)

Images

 
Western Blot: RAB3B Antibody (3F12) [H00005865-M01] - Analysis of RAB3B expression in transfected 293T cell line by RAB3B monoclonal antibody (M01), clone 3F12.Lane 1: RAB3B transfected lysate(24.758 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: RAB3B Antibody (3F12) [H00005865-M01] - Analysis of monoclonal antibody to RAB3B on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: RAB3B Antibody (3F12) [H00005865-M01] - Immunoperoxidase of monoclonal antibody to RAB3B on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]
Western Blot: RAB3B Antibody (3F12) [H00005865-M01] - RAB3B monoclonal antibody (M01), clone 3F12. Analysis of RAB3B expression in IMR-32.
ELISA: RAB3B Antibody (3F12) [H00005865-M01] - Detection limit for recombinant GST tagged RAB3B is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
3F12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RAB3B Antibody (3F12) Summary

Immunogen
RAB3B (AAH05035, 120 a.a. ~ 219 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IKTYSWDNAQVILVGNKCDMEEERVVPTEKGQLLAEQLGFDFFEASAKENISVRQAFERLVDAICDKMSDSLDTDPSMLGSSKNTRLSDTPPLLQQNCSC
Specificity
RAB3B - RAB3B, member RAS oncogene family
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RAB3B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactivity against recominant protein, transfected lysate and cell lysate for WB. It has been used for IF, IHC-P and ELISA.
Publications
Read Publications using H00005865-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAB3B Antibody (3F12)

  • brain antigen RAB3B
  • RAB3B, member RAS oncogene family
  • ras-related protein Rab-3B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45499
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-32871
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-56973
Species: Hu
Applications: ICC/IF, WB
NBP1-88769
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-91991
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-55113
Species: Hu, Pm, Mu
Applications: IHC, IHC-P, WB
NBP1-33110
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NB120-13253
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, IP, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP1-90927
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-37485
Species: Hu, Pm, Mu, Pm
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP1-87940
Species: Hu
Applications: IHC, IHC-P
NBP2-24510
Species: Ca, Hu, Pm
Applications: WB
H00004218-M02
Species: Hu, Mu, Ze
Applications: ELISA, ICC/IF, IHC, WB
H00005873-M02
Species: Hu, Mu, Rb
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, S-ELISA, WB
AF3444
Species: Hu
Applications: IHC, WB
AF682
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB

Publications for RAB3B Antibody (H00005865-M01)(3)

Reviews for RAB3B Antibody (H00005865-M01) (0)

There are no reviews for RAB3B Antibody (H00005865-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RAB3B Antibody (H00005865-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB3B Products

Array H00005865-M01

Bioinformatics Tool for RAB3B Antibody (H00005865-M01)

Discover related pathways, diseases and genes to RAB3B Antibody (H00005865-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB3B Antibody (H00005865-M01)

Discover more about diseases related to RAB3B Antibody (H00005865-M01).
 

Pathways for RAB3B Antibody (H00005865-M01)

View related products by pathway.

PTMs for RAB3B Antibody (H00005865-M01)

Learn more about PTMs related to RAB3B Antibody (H00005865-M01).
 

Research Areas for RAB3B Antibody (H00005865-M01)

Find related products by research area.

Blogs on RAB3B

There are no specific blogs for RAB3B, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB3B Antibody (3F12) and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB3B
Entrez
OMIM
Uniprot