RAB33B Antibody

Images

 
Immunohistochemistry-Paraffin: RAB33B Antibody [NBP2-13191] Staining of human stomach, lower shows distinct cytoplasmic positivity in superficial layer of glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAB33B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MAEEMESSLEASFSSSGAVSGASGFLPPARSRIFKIIV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAB33B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RAB33B Protein (NBP2-13191PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RAB33B Antibody

  • DKFZP434G099
  • MGC138182
  • RAB33B, member RAS oncogene family
  • ras-related protein Rab-33B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60928
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, EM, IHC, IHC-P
NBP2-31793
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-55113
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-00597
Species: Hu, Mk
Applications: WB, Flow, ICC/IF
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP2-53420
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88883
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-55368
Species: Hu
Applications: ICC/IF
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
NBP1-81804
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-31357
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30914
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13191
Species: Hu
Applications: IHC, IHC-P

Publications for RAB33B Antibody (NBP2-13191) (0)

There are no publications for RAB33B Antibody (NBP2-13191).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB33B Antibody (NBP2-13191) (0)

There are no reviews for RAB33B Antibody (NBP2-13191). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RAB33B Antibody (NBP2-13191) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB33B Products

Bioinformatics Tool for RAB33B Antibody (NBP2-13191)

Discover related pathways, diseases and genes to RAB33B Antibody (NBP2-13191). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB33B Antibody (NBP2-13191)

Discover more about diseases related to RAB33B Antibody (NBP2-13191).
 

Pathways for RAB33B Antibody (NBP2-13191)

View related products by pathway.

Research Areas for RAB33B Antibody (NBP2-13191)

Find related products by research area.

Blogs on RAB33B

There are no specific blogs for RAB33B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB33B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB33B