We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Rab27a Recombinant Protein Antigen

Images

 
There are currently no images for Rab27a Protein (NBP1-83327PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Rab27a Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RAB27A.

Source: E. coli

Amino Acid Sequence: LQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RAB27A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83327.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Rab27a Recombinant Protein Antigen

  • GS2
  • GS2rab-27
  • GTP-binding protein Ram
  • HsT18676
  • Rab-27
  • Rab27a
  • RAB27A, member RAS oncogene family
  • RAB27MGC117246
  • RAM
  • RAMras-related protein Rab-27A

Background

RAB27A is encoded by this gene belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Mutations in this gene are associated with Griscelli syndrome type 2. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-45883
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-92156
Species: Hu
Applications: ICC/IF, KD, WB
NBP1-89538
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NB100-41385
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, PEP-ELISA, WB
NBP1-86176
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-1278
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP2-45499
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-84764
Species: Hu
Applications: IHC,  IHC-P
NBP2-94887
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
NBP1-91991
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-38770
Species: Hu
Applications: WB
H00004218-M02
Species: Hu, Mu, Ze
Applications: ELISA, ICC/IF, IHC, WB
NBP1-83327PEP
Species: Hu
Applications: AC

Publications for Rab27a Protein (NBP1-83327PEP) (0)

There are no publications for Rab27a Protein (NBP1-83327PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rab27a Protein (NBP1-83327PEP) (0)

There are no reviews for Rab27a Protein (NBP1-83327PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Rab27a Protein (NBP1-83327PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Rab27a Products

Research Areas for Rab27a Protein (NBP1-83327PEP)

Find related products by research area.

Blogs on Rab27a

There are no specific blogs for Rab27a, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Rab27a Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB27A