We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

RAB19B Recombinant Protein Antigen

Images

 
There are currently no images for RAB19B Protein (NBP2-13188PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RAB19B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RAB19.

Source: E. coli

Amino Acid Sequence: LIGNKCDLWEKRHVLFEDACTLAEKYGLLAVLETSAKES

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RAB19
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13188.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RAB19B Recombinant Protein Antigen

  • RAB19, member RAS oncogene family
  • RAB19BGTP-binding protein RAB19B
  • ras-related protein Rab-19

Background

RAB19B, also known as Ras-related protein Rab-19, is a 24 kDa 217 amino acid protein with a longer 30kDa 264 isoform. RAB19B belongs to the Rab family and can be found in the cell membrane. Current research on RAB19B is being conducted in relation to the diseases pilocytic astrocytoma and astrocytoma. RAB19B is linked to the transport pathway where it interacts with RANBP1, RANBP2, RANGAP1, ARHGDIA and KPNB1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61825
Species: Hu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-86528
Species: Hu
Applications: IHC,  IHC-P
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-80789
Species: Hu
Applications: IHC,  IHC-P, KD, WB
NBP2-45497
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
MAB1230
Species: Hu, Mu, Rt
Applications: ICC, IHC, KO, Simple Western, WB
NBP1-47668
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-61832
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-23392
Species: Hu
Applications: PAGE, WB
NBP3-16825
Species: Hu
Applications: ICC/IF, WB
NBP3-32885
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-91991
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00339122-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, WB
NBP1-31631
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
H00008826-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, S-ELISA, WB

Publications for RAB19B Protein (NBP2-13188PEP) (0)

There are no publications for RAB19B Protein (NBP2-13188PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB19B Protein (NBP2-13188PEP) (0)

There are no reviews for RAB19B Protein (NBP2-13188PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RAB19B Protein (NBP2-13188PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RAB19B Products

Array NBP2-13188PEP

Research Areas for RAB19B Protein (NBP2-13188PEP)

Find related products by research area.

Blogs on RAB19B

There are no specific blogs for RAB19B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RAB19B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB19