Recombinant Human RAB19B Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RAB19B Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 166 - 264 of Human RAB19B partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GAANVVIMLIGNKCDLWEKRHVLFEDACTLAEKYGLLAVLETSAKESKNIEEVFVLMAKELIARNSLHLYGESALNGLPLDSSPVLMAQGPSEKTHCTC

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RAB19

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RAB19B Protein

  • RAB19, member RAS oncogene family
  • RAB19BGTP-binding protein RAB19B
  • ras-related protein Rab-19

Background

RAB19B - GTP-binding protein RAB19B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

24320002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-86528
Species: Hu
Applications: IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-80789
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45497
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IF
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-92307
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00028996-M03
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
21740002
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00339122-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-31631
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06529
Species: Hu
Applications: WB, IHC-P, IP, PLA
H00401409-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for RAB19B Partial Recombinant Protein (H00401409-Q01) (0)

There are no publications for RAB19B Partial Recombinant Protein (H00401409-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB19B Partial Recombinant Protein (H00401409-Q01) (0)

There are no reviews for RAB19B Partial Recombinant Protein (H00401409-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB19B Partial Recombinant Protein (H00401409-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RAB19B Products

Bioinformatics Tool for RAB19B Partial Recombinant Protein (H00401409-Q01)

Discover related pathways, diseases and genes to RAB19B Partial Recombinant Protein (H00401409-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for RAB19B Partial Recombinant Protein (H00401409-Q01)

Find related products by research area.

Blogs on RAB19B

There are no specific blogs for RAB19B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
RAB19B Antibody
NBP2-13188

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RAB19B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB19