We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

QDPR Recombinant Protein Antigen

Images

 
There are currently no images for QDPR Recombinant Protein Antigen (NBP2-49455PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

QDPR Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human QDPR.

Source: E. coli

Amino Acid Sequence: WVASVDVVENEEASASIIVKMTDSFTEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
QDPR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49455.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for QDPR Recombinant Protein Antigen

  • DHPR member 1
  • DHPR
  • HDHPR
  • PKU2
  • QDPR
  • quinoid dihydropteridine reductaseFLJ42391
  • SDR33C1

Background

QDPR encodes the enzyme dihydropteridine reductase, which catalyzes the NADH-mediated reduction of quinonoid dihydrobiopterin. This enzyme is an essential component of the pterin-dependent aromatic amino acid hydroxylating systems. Mutations in this gene resulting in QDPR deficiency include aberrant splicing, amino acid substitutions, insertions, or premature terminations. Dihydropteridine reductase deficiency presents as atypical phenylketonuria due to insufficient production of biopterin, a cofactor for phenylalanine hydroxylase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-542
Species: Gp, Hu, Mu, Rb, Rt
Applications: Flow, IHC, IHC-Fr,  IHC-P, IP, WB
NB300-543
Species: Am, Bv, Ca, Ma, Fi, Hu, Ma-Mn, Mu, Pm, Rb, Rt, Sh
Applications: B/N, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-80917
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-80143
Species: Am, Bv, Ca, Ch, Fi, Gp, Hu, Mu, Po, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
MAB5745
Species: Hu
Applications: IHC, WB
NBP1-86125
Species: Hu
Applications: IHC,  IHC-P
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-1919
Species: Ca, Fe, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
H00001719-M01
Species: Hu, Mu, Rt, Ye
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-32975
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP2-03256
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP1-84949
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
7954-GM/CF
Species: Hu
Applications: BA
NBP2-42388
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-87417
Species: Hu
Applications: ICC/IF,  IHC-P
NBP1-84297
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB100-182
Species: Av, Ca, Hu, Ma, Mu, Pm, Rt, Ze
Applications: ChIP, ChIP, Flow, IB, ICC/IF, IHC,  IHC-P, IP, KD, KO, RNAi, Simple Western, WB
NBP2-49455PEP
Species: Hu
Applications: AC

Publications for QDPR Recombinant Protein Antigen (NBP2-49455PEP) (0)

There are no publications for QDPR Recombinant Protein Antigen (NBP2-49455PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for QDPR Recombinant Protein Antigen (NBP2-49455PEP) (0)

There are no reviews for QDPR Recombinant Protein Antigen (NBP2-49455PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for QDPR Recombinant Protein Antigen (NBP2-49455PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional QDPR Products

Blogs on QDPR

There are no specific blogs for QDPR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our QDPR Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol QDPR