QARS Antibody (5F5)

Images

 
Western Blot: QARS Antibody (5F5) [H00005859-M01] - QARS monoclonal antibody (M01), clone 5F5 Analysis of QARS expression in HeLa.
Immunohistochemistry-Paraffin: QARS Antibody (5F5) [H00005859-M01] - Analysis of monoclonal antibody to QARS on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.
Western Blot: QARS Antibody (5F5) [H00005859-M01] - Analysis of QARS expression in transfected 293T cell line by QARS monoclonal antibody (M01), clone 5F5.Lane 1: QARS transfected lysate(87.8 KDa).Lane 2: ...read more
Immunoprecipitation: QARS Antibody (5F5) [H00005859-M01] - Analysis of QARS transfected lysate using anti-QARS monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with QARS MaxPab rabbit polyclonal ...read more
Sandwich ELISA: QARS Antibody (5F5) [H00005859-M01] - Detection limit for recombinant GST tagged QARS is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P, IP
Clone
5F5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

QARS Antibody (5F5) Summary

Immunogen
QARS (NP_005042 677 a.a. - 775 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FIHWVSQPLMCEVRLYERLFQHKNPEDPTEVPGGFLSDLNLASLHVVDAALVDCSVALAKPFDKFQFERLGYFSVDPDSHQGKLVFNRTVTLKEDPGKV
Specificity
QARS - glutaminyl-tRNA synthetase
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
QARS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.
Publications
Read Publication using H00005859-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for QARS Antibody (5F5)

  • EC 6.1.1
  • EC 6.1.1.18
  • GLNRS
  • glutamine tRNA ligase
  • Glutamine--tRNA ligase
  • glutamine-tRNA synthetase
  • glutaminyl-tRNA synthetase
  • PRO2195

Background

Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. In metazoans, 9 aminoacyl-tRNA synthetases specific for glutamine (gln), glutamic acid (glu), and 7 other amino acids are associated within a multienzyme complex. Although present in eukaryotes, glutaminyl-tRNA synthetase (QARS) is absent from many prokaryotes, mitochondria, and chloroplasts, in which Gln-tRNA(Gln) is formed by transamidation of the misacylated Glu-tRNA(Gln). Glutaminyl-tRNA synthetase belongs to the class-I aminoacyl-tRNA synthetase family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85937
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP2-13640
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20744
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-54653
Species: Hu
Applications: WB
NBP1-86889
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92106
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83854
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88032
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87706
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82077
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-20928
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-31923
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for QARS Antibody (H00005859-M01)(1)

Reviews for QARS Antibody (H00005859-M01) (0)

There are no reviews for QARS Antibody (H00005859-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for QARS Antibody (H00005859-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional QARS Products

Bioinformatics Tool for QARS Antibody (H00005859-M01)

Discover related pathways, diseases and genes to QARS Antibody (H00005859-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for QARS Antibody (H00005859-M01)

Discover more about diseases related to QARS Antibody (H00005859-M01).
 

Pathways for QARS Antibody (H00005859-M01)

View related products by pathway.

Blogs on QARS

There are no specific blogs for QARS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our QARS Antibody (5F5) and receive a gift card or discount.

Bioinformatics

Gene Symbol QARS
Entrez
OMIM
Uniprot