Recombinant Human PXK Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human PXK Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 351-450 of Human PXK

Source: Wheat Germ

Amino Acid Sequence: PDSVPVDSFPPAPSMAVVAVLESTLSCEACKNGMPTISRLLQMPLFSDVLLTTSEKPQFKIPTKLKEALRIAKECIEKRLIEEQKQIHQHRRLTRAQSHH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PXK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PXK Protein

  • FLJ20335
  • K-ATPase long form
  • K-ATPase
  • modulator of Na
  • MONaKA
  • PX domain containing serine/threonine kinase
  • PX domain-containing protein kinase-like protein
  • PX ser/thr kinase v2
  • PX serine/threonine kinase

Background

PXK binds to the Na,K-ATPase beta-1 (ATP1B1; MIM 182330) and beta-3 (ATP1B3; MIM 601867) subunits and modulates both Na,K-ATPase enzymatic and ion pump activities (Mao et al., 2005 [PubMed 16135750]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Single Cell Western
NBP1-18933
Species: Hu, Mu
Applications: WB, IP
NBP2-67868
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF8005
Species: Hu
Applications: WB
NB100-1092
Species: Hu
Applications: WB, ChIP, Flow, PEP-ELISA
MAB3428
Species: Hu
Applications: WB, IHC
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87825
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000640-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow
AF3206
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
MAB195
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA, RIA
NBP1-91235
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB5519
Species: Mu
Applications: Flow, CyTOF-ready, ICC
MAB2555
Species: Mu
Applications: WB, Flow, CyTOF-ready
NB100-56699
Species: Hu, Mu, Rt
Applications: WB, IP
AF1330
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready, ICC
NBP1-77533
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P, IP, CyTOF-ready
H00054899-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for PXK Partial Recombinant Protein (H00054899-Q01) (0)

There are no publications for PXK Partial Recombinant Protein (H00054899-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PXK Partial Recombinant Protein (H00054899-Q01) (0)

There are no reviews for PXK Partial Recombinant Protein (H00054899-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PXK Partial Recombinant Protein (H00054899-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PXK Products

Bioinformatics Tool for PXK Partial Recombinant Protein (H00054899-Q01)

Discover related pathways, diseases and genes to PXK Partial Recombinant Protein (H00054899-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PXK Partial Recombinant Protein (H00054899-Q01)

Discover more about diseases related to PXK Partial Recombinant Protein (H00054899-Q01).
 

Pathways for PXK Partial Recombinant Protein (H00054899-Q01)

View related products by pathway.

PTMs for PXK Partial Recombinant Protein (H00054899-Q01)

Learn more about PTMs related to PXK Partial Recombinant Protein (H00054899-Q01).
 

Research Areas for PXK Partial Recombinant Protein (H00054899-Q01)

Find related products by research area.

Blogs on PXK

There are no specific blogs for PXK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ATG5 Antibody
NB110-53818
PXK Antibody
NBP1-83663

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PXK Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PXK