Recombinant Human PXK Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PXK Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 351-450 of Human PXK partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PDSVPVDSFPPAPSMAVVAVLESTLSCEACKNGMPTISRLLQMPLFSDVLLTTSEKPQFKIPTKLKEALRIAKECIEKRLIEEQKQIHQHRRLTRAQSHH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PXK

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PXK Protein

  • FLJ20335
  • K-ATPase long form
  • K-ATPase
  • modulator of Na
  • MONaKA
  • PX domain containing serine/threonine kinase
  • PX domain-containing protein kinase-like protein
  • PX ser/thr kinase v2
  • PX serine/threonine kinase

Background

PXK binds to the Na,K-ATPase beta-1 (ATP1B1; MIM 182330) and beta-3 (ATP1B3; MIM 601867) subunits and modulates both Na,K-ATPase enzymatic and ion pump activities (Mao et al., 2005 [PubMed 16135750]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-18933
Species: Hu, Mu
Applications: WB, IP
NBP2-00851
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF8005
Species: Hu
Applications: WB
NB100-1092
Species: Hu
Applications: WB, ChIP, Flow, PEP-ELISA
MAB3428
Species: Hu
Applications: WB, IHC
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00007297-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
H00000640-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow
NB500-519
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
MAB195
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-91235
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IF
MAB5519
Species: Mu
Applications: Flow, CyTOF-ready, ICC
MAB2555
Species: Mu
Applications: WB, Flow, CyTOF-ready
NB100-56699
Species: Hu, Mu, Rt
Applications: WB, IP
AF1875
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready
NBP1-77533
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P, IP, CyTOF-ready
H00054899-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PXK Partial Recombinant Protein (H00054899-Q01) (0)

There are no publications for PXK Partial Recombinant Protein (H00054899-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PXK Partial Recombinant Protein (H00054899-Q01) (0)

There are no reviews for PXK Partial Recombinant Protein (H00054899-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PXK Partial Recombinant Protein (H00054899-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PXK Products

Bioinformatics Tool for PXK Partial Recombinant Protein (H00054899-Q01)

Discover related pathways, diseases and genes to PXK Partial Recombinant Protein (H00054899-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PXK Partial Recombinant Protein (H00054899-Q01)

Discover more about diseases related to PXK Partial Recombinant Protein (H00054899-Q01).
 

Pathways for PXK Partial Recombinant Protein (H00054899-Q01)

View related products by pathway.

PTMs for PXK Partial Recombinant Protein (H00054899-Q01)

Learn more about PTMs related to PXK Partial Recombinant Protein (H00054899-Q01).
 

Research Areas for PXK Partial Recombinant Protein (H00054899-Q01)

Find related products by research area.

Blogs on PXK

There are no specific blogs for PXK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ATG5 Antibody
NB110-53818
PXK Antibody
NBP1-83663

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PXK Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PXK