PTTG1IP Antibody (4C11)

Images

 
Western Blot: PTTG1IP Antibody (4C11) [H00000754-M04] - Analysis of PTTG1IP expression in transfected 293T cell line by PTTG1IP monoclonal antibody (M04), clone 4C11. Lane 1: PTTG1IP transfected lysatE (20.3 KDa). Lane ...read more
Immunocytochemistry/ Immunofluorescence: PTTG1IP Antibody (4C11) [H00000754-M04] - Analysis of monoclonal antibody to PTTG1IP on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: PTTG1IP Antibody (4C11) [H00000754-M04] - Detection limit for recombinant GST tagged PTTG1IP is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4C11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PTTG1IP Antibody (4C11) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
PTTG1IP (AAH20983, 1 a.a. ~ 180 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAPGVARGPTPYWRLRLGGAALLLLLIPVAAAQEPPGAACSQNTNKTCEECLKNVSCLWCNTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEALIITMSVVGGTLLLGIAICCCCCCRRKRSRKPDRSEEKAMREREERRIRQEERRAEMKTRHDEIRKKYGLFKEENPYARFENN
Specificity
PTTG1IP - pituitary tumor-transforming 1 interacting protein (4C11)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PTTG1IP
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using
H00000754-M04 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PTTG1IP Antibody (4C11)

  • C21orf1putative surface glycoprotein C21orf1 precursor10C21orf3pituitary tumor-transforming gene 1 protein-interacting protein
  • PBFPTTG-binding factor
  • pituitary tumor-transforming 1 interacting protein
  • Pituitary tumor-transforming gene protein-binding factor

Background

The encoded protein, which directly binds to pituitary tumor-transforming gene 1 protein (PTTG1), facilitates the nuclear translocation of PTTG1 and potentiates the transcriptional activation of basic fibroblast growth factor by PTTG1. The gene product localizes to both the cytoplasm and nucleus. Its NLS is required for its own nuclear localization, the nuclear localization of PTTG1, and its interaction with PTTG1. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20287
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
233-FB
Species: Hu
Applications: BA
NBP2-57308
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB600-1287
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
236-EG
Species: Hu
Applications: BA
NBP3-17459
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DY417
Species: Mu
Applications: ELISA
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: IHC, IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
AF1052
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
NBP2-42225
Species: Ca, Hu
Applications: B/N, DB, EM, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC-WhMt, IP, In vitro, WB
NBP2-61712
Species: Hu
Applications: ELISA, Flow, IHC, IHC-P, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
H00000754-M04
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for PTTG1IP Antibody (H00000754-M04)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for PTTG1IP Antibody (H00000754-M04) (0)

There are no reviews for PTTG1IP Antibody (H00000754-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PTTG1IP Antibody (H00000754-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTTG1IP Antibody (4C11) and receive a gift card or discount.

Bioinformatics

Gene Symbol PTTG1IP
Entrez
Uniprot