We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PTPRD Recombinant Protein Antigen

Images

 
There are currently no images for PTPRD Recombinant Protein Antigen (NBP2-49153PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PTPRD Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PTPRD.

Source: E. coli

Amino Acid Sequence: GREVELKPYIAAHFDVLPTEFTLGDDKHYGGFTNKQLQSGQEYVFFVLAVMEHAESKMYATSPYSDPVVSMDLDPQPITDEEE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PTPRD
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49153.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PTPRD Recombinant Protein Antigen

  • HPTPDELTA
  • HPTPMGC119752
  • MGC119750
  • MGC119751
  • protein tyrosine phosphatase, receptor type, D
  • Protein-tyrosine phosphatase delta
  • PTP delta
  • PTPD
  • PTPdelta
  • PTP-delta
  • PTPDMGC119753
  • PTPRD
  • receptor type, delta polypeptide
  • receptor-type tyrosine-protein phosphatase delta
  • R-PTP-Delta
  • RPTP-Delta

Background

The protein encoded by the PTPRD gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains an extracellular region, a single transmembrane segment and two tandem intracytoplasmic catalytic domains, thus represents a receptor-type PTP. The extracellular region of this protein is composed of three Ig-like and eight fibronectin type III-like domains. Studies of the similar genes in chick and fly suggest the role of this PTP is in promoting neurite growth, and regulating neurons axon guidance. Multiple tissue specific alternatively spliced transcript variants of this gene have been reported. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7475
Species: Hu, Rt
Applications: WB
AF1657
Species: Mu
Applications: WB
H00005250-B02P
Species: Hu
Applications: ICC/IF, WB
NBP2-42172
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
DHAPG0
Species: Hu
Applications: ELISA
NB300-917
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
AF3430
Species: Hu
Applications: ICC, WB
NBP3-14454
Species: Hu
Applications: IHC,  IHC-P
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP1-89654
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-24716
Species: Hu, Mu, Pm
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-41247
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-89062
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-02332
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-46018
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
NBP2-49153PEP
Species: Hu
Applications: AC

Publications for PTPRD Recombinant Protein Antigen (NBP2-49153PEP) (0)

There are no publications for PTPRD Recombinant Protein Antigen (NBP2-49153PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTPRD Recombinant Protein Antigen (NBP2-49153PEP) (0)

There are no reviews for PTPRD Recombinant Protein Antigen (NBP2-49153PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PTPRD Recombinant Protein Antigen (NBP2-49153PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PTPRD Products

Research Areas for PTPRD Recombinant Protein Antigen (NBP2-49153PEP)

Find related products by research area.

Blogs on PTPRD

There are no specific blogs for PTPRD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PTPRD Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PTPRD