Recombinant Human PTPLAD1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PTPLAD1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-113 of Human HSPC121 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLEFLDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PTPLAD1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PTPLAD1 Protein

  • BIND1
  • B-ind1
  • Butyrate-induced protein 1
  • butyrate-induced transcript 1
  • EC 4.2.1.-
  • FLJ90376
  • HACD3
  • hB-ind1
  • HSPC121,3-hydroxyacyl-CoA dehydratase 3
  • protein tyrosine phosphatase-like A domain containing 1
  • Protein tyrosine phosphatase-like protein PTPLAD1
  • Protein-tyrosine phosphatase-like A domain-containing protein 1

Background

PTPLAD1 - butyrate-induced transcript 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-57586
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, IHC, IHC-P
NB300-576
Species: Hu, Mu, Rt, Ch, GP, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF3580
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB100-56161
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
MAB4648
Species: Hu, Mu, Rt
Applications: WB, ICC
AF7250
Species: Hu
Applications: IHC
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-56244
Species: Hu
Applications: WB, ICC/IF
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-36431
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-68211
Species: Hu
Applications: WB, IP
MAB6799
Species: Hu
Applications: WB, IHC
H00051495-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PTPLAD1 Partial Recombinant Protein (H00051495-Q01) (0)

There are no publications for PTPLAD1 Partial Recombinant Protein (H00051495-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTPLAD1 Partial Recombinant Protein (H00051495-Q01) (0)

There are no reviews for PTPLAD1 Partial Recombinant Protein (H00051495-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PTPLAD1 Partial Recombinant Protein (H00051495-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PTPLAD1 Products

Bioinformatics Tool for PTPLAD1 Partial Recombinant Protein (H00051495-Q01)

Discover related pathways, diseases and genes to PTPLAD1 Partial Recombinant Protein (H00051495-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTPLAD1 Partial Recombinant Protein (H00051495-Q01)

Discover more about diseases related to PTPLAD1 Partial Recombinant Protein (H00051495-Q01).
 

Pathways for PTPLAD1 Partial Recombinant Protein (H00051495-Q01)

View related products by pathway.

Research Areas for PTPLAD1 Partial Recombinant Protein (H00051495-Q01)

Find related products by research area.

Blogs on PTPLAD1

There are no specific blogs for PTPLAD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PTPLAD1 Antibody
NBP1-88597
p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PTPLAD1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PTPLAD1