PTPIP51 Antibody

Images

 
Western Blot: PTPIP51 Antibody [NBP1-84738] - Analysis in human cell line CACO-2.
Immunocytochemistry/ Immunofluorescence: PTPIP51 Antibody [NBP1-84738] - Staining of human cell line U-2 OS shows positivity in mitochondria.
Immunohistochemistry-Paraffin: PTPIP51 Antibody [NBP1-84738] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PTPIP51 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DEVSCETVKMGRKDSLDLEEEAASGASSALEAGGSSGLEDVLPLLQQADELHRGDEQGKREGFQLLLNNKLVYGSRQDFLWRLARAYSDMCELTEEVSEKKSYALDGKEEAEAALEKGDESADCHLWYAVLCG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM82A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PTPIP51 Protein (NBP1-84738PEP)
Publications
Read Publication using NBP1-84738.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PTPIP51 Antibody

  • Cerebral protein 10
  • FAM82Cmicrotubule-associated protein
  • family with sequence similarity 82, member A2
  • FLJ10579
  • hRMD-3
  • Protein FAM82A2
  • Protein FAM82C
  • Protein tyrosine phosphatase-interacting protein 51
  • ptpip51
  • PTPIP51family with sequence similarity 82, member C
  • regulator of microtubule dynamics 3
  • regulator of microtubule dynamics protein 3
  • RMD3
  • RMD-3
  • TCPTP-interacting protein 51

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1366
Species: Hu
Applications: WB, Simple Western, IHC
MAB1930
Species: Hu, Mu, Rt
Applications: WB
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
NBP2-01597
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-89112
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NB500-519
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP1-80611
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PTPIP51 Antibody (NBP1-84738)(1)

Reviews for PTPIP51 Antibody (NBP1-84738) (0)

There are no reviews for PTPIP51 Antibody (NBP1-84738). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PTPIP51 Antibody (NBP1-84738) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTPIP51 Products

Bioinformatics Tool for PTPIP51 Antibody (NBP1-84738)

Discover related pathways, diseases and genes to PTPIP51 Antibody (NBP1-84738). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTPIP51 Antibody (NBP1-84738)

Discover more about diseases related to PTPIP51 Antibody (NBP1-84738).
 

Pathways for PTPIP51 Antibody (NBP1-84738)

View related products by pathway.

PTMs for PTPIP51 Antibody (NBP1-84738)

Learn more about PTMs related to PTPIP51 Antibody (NBP1-84738).

Blogs on PTPIP51

There are no specific blogs for PTPIP51, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTPIP51 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM82A2