PTPIP51 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PTPIP51 Antibody [NBP1-84738] - Staining of human cell line U-2 OS shows positivity in mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PTPIP51 Antibody [NBP1-84738] - Staining of human kidney shows strong cytoplasmic granular positivity in cells in tubules.

Immunohistochemistry-Paraffin: PTPIP51 Antibody [NBP1-84738] - Staining of human skin shows moderate to strong cytoplasmic positivity in keratinocytes.

Immunohistochemistry-Paraffin: PTPIP51 Antibody [NBP1-84738] - Staining of human small intestine shows strong cytoplasmic granular positivity in glandular cells.

Immunohistochemistry-Paraffin: PTPIP51 Antibody [NBP1-84738] - Staining of human testis shows strong cytoplasmic granular positivity in cells in seminiferous ducts.

Analysis in human cell line CACO-2.

Staining of human skeletal muscle shows very weak cytoplasmic granular positivity in myocytes.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PTPIP51 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PTPIP51 Antibody - BSA Free (NBP1-84738) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-PTPIP51 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DEVSCETVKMGRKDSLDLEEEAASGASSALEAGGSSGLEDVLPLLQQADELHRGDEQGKREGFQLLLNNKLVYGSRQDFLWRLARAYSDMCELTEEVSEKKSYALDGKEEAEAALEKGDESADCHLWYAVLCG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RMDN3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PTPIP51 Protein (NBP1-84738PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PTPIP51 Antibody - BSA Free

• Cerebral protein 10
• FAM82Cmicrotubule-associated protein
• family with sequence similarity 82, member A2
• FLJ10579
• hRMD-3
• Protein FAM82A2
• Protein FAM82C
• Protein tyrosine phosphatase-interacting protein 51
• ptpip51
• PTPIP51family with sequence similarity 82, member C
• regulator of microtubule dynamics 3
• regulator of microtubule dynamics protein 3
• RMD3
• RMD-3
• TCPTP-interacting protein 51

Background

PTPIP51 may participate in differentiation and apoptosis of keratinocytes. Overexpression induces apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PTPIP51 Antibody (NBP1-84738)(3)

Publications using NBP1-84738

• Pila-Castellanos I, Molino D, McKellar J et al. Mitochondrial morphodynamics alteration induced by influenza virus infection as a new antiviral strategy PLoS pathogens 2021-02-01 [PMID: 33596274] (ICC/IF, Human)
• Molino, D, Pila-Castellanos, I Et al. Chemical targeting of NEET proteins reveals their function in mitochondrial morphodynamics. EMBO Rep 2020-12-03 [PMID: 33180995] (ICC/IF, IHC-Fr, Rat)
• De Vos KJ, Morotz GM, Stoica R et al. VAPB interacts with the mitochondrial protein PTPIP51 to regulate calcium homeostasis. Hum Mol Genet 2012-03-01 [PMID: 22131369]

Bioinformatics

• Gene Symbol: RMDN3