PTPIP51 Antibody

Images

 
Western Blot: PTPIP51 Antibody [NBP1-62474] - Titration: 0.2-1 ug/ml, Positive Control: Transfected 293T.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PTPIP51 Antibody Summary

Immunogen
Synthetic peptides corresponding to PTPIP51 The peptide sequence was selected from the middle region of PTPIP51. Peptide sequence LSATVEDALQSFLKAEELQPGFSKAGRVYISKCYRELGKNSEARWWMKLA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RMDN3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PTPIP51 and was validated on Western blot.
Theoretical MW
52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control
PTPIP51 Knockout HeLa Cell Lysate

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PTPIP51 Antibody

  • Cerebral protein 10
  • FAM82Cmicrotubule-associated protein
  • family with sequence similarity 82, member A2
  • FLJ10579
  • hRMD-3
  • Protein FAM82A2
  • Protein FAM82C
  • Protein tyrosine phosphatase-interacting protein 51
  • ptpip51
  • PTPIP51family with sequence similarity 82, member C
  • regulator of microtubule dynamics 3
  • regulator of microtubule dynamics protein 3
  • RMD3
  • RMD-3
  • TCPTP-interacting protein 51

Background

FAM82C (PTPIP51) may participate in differentiation and apoptosis of keratinocytes. Overexpression of FAM82C (PTPIP51) protein induces apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1366
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-48528
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Pm
Applications: WB, Simple Western
NBP2-01597
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-89112
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59744
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, IHC, IHC-Fr
AF3206
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-61780
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56599
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, Flow-IC
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PTPIP51 Antibody (NBP1-62474) (0)

There are no publications for PTPIP51 Antibody (NBP1-62474).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTPIP51 Antibody (NBP1-62474) (0)

There are no reviews for PTPIP51 Antibody (NBP1-62474). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PTPIP51 Antibody (NBP1-62474) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PTPIP51 Products

Bioinformatics Tool for PTPIP51 Antibody (NBP1-62474)

Discover related pathways, diseases and genes to PTPIP51 Antibody (NBP1-62474). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTPIP51 Antibody (NBP1-62474)

Discover more about diseases related to PTPIP51 Antibody (NBP1-62474).
 

Pathways for PTPIP51 Antibody (NBP1-62474)

View related products by pathway.

PTMs for PTPIP51 Antibody (NBP1-62474)

Learn more about PTMs related to PTPIP51 Antibody (NBP1-62474).

Blogs on PTPIP51

There are no specific blogs for PTPIP51, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTPIP51 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RMDN3
Uniprot