PTPIP51 Antibody (5H6A5)

Western Blot: PTPIP51 Antibody (5H6A5) [NBP3-33323] - Western blot analysis of various lysates using PTPIP51 Rabbit mAb at1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 120s.

• Reactivity: Rt
• Applications: WB, ELISA
• Clone: 5H6A5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

PTPIP51 Antibody (5H6A5) Summary

• Description: Novus Biologicals Rabbit PTPIP51 Antibody (5H6A5) (NBP3-33323) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PTPIP51 (NP_060615.1).
  
  Sequence:
  VSCETVKMGRKDSLDLEEEAASGASSALEAGGSSGLEDVLPLLQQADELHRGDEQGKREGFQLLLNNKLVYGSRQDFLWRLARAYSDMCELTEEVSEKKSY
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: RMDN3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:1000 - 1:5000
• Theoretical MW: 52 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for PTPIP51 Antibody (5H6A5)

• Cerebral protein 10
• FAM82Cmicrotubule-associated protein
• family with sequence similarity 82, member A2
• FLJ10579
• hRMD-3
• Protein FAM82A2
• Protein FAM82C
• Protein tyrosine phosphatase-interacting protein 51
• ptpip51
• PTPIP51family with sequence similarity 82, member C
• regulator of microtubule dynamics 3
• regulator of microtubule dynamics protein 3
• RMD3
• RMD-3
• TCPTP-interacting protein 51

Background

PTPIP51 may participate in differentiation and apoptosis of keratinocytes. Overexpression induces apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RMDN3