![Western Blot: PTH2R Antibody [NBP2-88101] - WB Suggested Anti-PTH2R Antibody. Titration: 1.0 ug/ml. Positive Control: OVCAR-3 Whole CellPTH2R is supported by BioGPS gene expression data to be expressed in OVCAR3](http://images.novusbio.com/fullsize/PTH2R-Antibody-Western-Blot-NBP2-88101-img0001.jpg "Western Blot: PTH2R Antibody [NBP2-88101] - WB Suggested Anti-PTH2R Antibody. Titration: 1.0 ug/ml. Positive Control: OVCAR-3 Whole CellPTH2R is supported by BioGPS gene expression data to be expressed in OVCAR3")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | Novus Biologicals Rabbit PTH2R Antibody - BSA Free (NBP2-88101) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human PTH2R. Peptide sequence: NSEQDCLPHSFHEETKEDSGRQGDDILMEKPSRPMESNPDTEGCQGETED The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PTH2R |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Immunohistochemistry PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Immunohistochemistry_16650.jpg)
![Western Blot PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Western_Blot_16656.jpg)
![Neutralization Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Block_Neutralize_8779.jpg)
![Western Blot Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Western_Blot_20179.jpg)
![Immunohistochemistry Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1445_mouse-rat-prolactin-affinity-purified-polyclonal-ab-immunohistochemistry-19202393922..jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for PTH2R Antibody (NBP2-88101)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PTH2R |
![Immunohistochemistry PTHLH/PTHrP Antibody (677939) [Unconjugated]](https://images.novusbio.com/images2/PTHLH_MAB6734_Immunohistochemistry_10816.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
