PTGFR Antibody - BSA Free Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PTGFR. Peptide sequence: RFYLLLFSFLGLLALGVSLLCNAITGITLLRVKFKSQQHRQGRSHHLEMV The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PTGFR |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Theoretical MW |
37 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for PTGFR Antibody - BSA Free
Background
The prostaglandin F2-alpha receptor is a member of the Prostanoid Receptor subfamily. Along with various other prostaglandin receptors, it mediates the effects of prostaglandin F(2-alpha) which include modulation of intraocular pressure, corpus luteum regression, and possibly uterine smooth muscle contraction. Alternative mRNA splicing gives rise to two isoforms, FP(A) and FP(B), that differ in their intracellular carboxyl termini and result in different mechanisms for receptor internalization. Prostaglandin F2-alpha receptor expression has been documented in eye, ovary, placenta, and uterus. ESTs have been isolated from placental libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: Flow, ICC/IF, WB
Species: Bv, Hu, Pm, Pm
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Bt, Hu, Pm, Pm
Applications: IHC, IHC-P
Species: Ca, Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: WB
Publications for PTGFR Antibody (NBP2-82318) (0)
There are no publications for PTGFR Antibody (NBP2-82318).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PTGFR Antibody (NBP2-82318) (0)
There are no reviews for PTGFR Antibody (NBP2-82318).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PTGFR Antibody (NBP2-82318) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PTGFR Products
Research Areas for PTGFR Antibody (NBP2-82318)
Find related products by research area.
|
Blogs on PTGFR