PTGER3 Antibody


Western Blot: PTGER3 Antibody [NBP1-84835] - Analysis in control (vector only transfected HEK293T lysate) and PTGER3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T more
Immunohistochemistry-Paraffin: PTGER3 Antibody [NBP1-84835] - Staining of human smooth muscle shows moderate cytoplasmic positivity in smooth muscle cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

PTGER3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVS
Specificity of human PTGER3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
PTGER3 Lysate (NBP2-66299)
Control Peptide
PTGER3 Protein (NBP1-84835PEP)
Read Publication using NBP1-84835.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23227994)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PTGER3 Antibody

  • EP3
  • EP3EP3e
  • EP3-I
  • EP3-II
  • EP3-III
  • EP3-IV
  • MGC141828
  • MGC141829
  • MGC27302
  • PGE receptor EP3 subtype
  • PGE receptor, EP3 subtype
  • PGE2 receptor EP3 subtype
  • PGE2-R
  • prostaglandin E receotor EP3 subtype 3 isoform
  • prostaglandin E receptor 3 (subtype EP3)
  • prostaglandin E2 receptor EP3 subtype
  • prostaglandin receptor (PGE-2)
  • Prostanoid EP3 receptor
  • PTGER3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mk
Applications: IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Eq, Mk, Pm
Applications: IHC-P, ICC
Species: Hu, Mu, Po
Applications: WB, Simple Western, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PTGER3 Antibody (NBP1-84835)(1)

Reviews for PTGER3 Antibody (NBP1-84835) (0)

There are no reviews for PTGER3 Antibody (NBP1-84835). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PTGER3 Antibody (NBP1-84835). (Showing 1 - 1 of 1 FAQ).

  1. I received an e-mail about some complimentary antibody samples that are available. We work with Ptger3 and have tried several antibodies (Santa Cruz, Abcam, Cayman) but haven't found an antibody that works. I was wondering if you would be willing to send us a complimentary sample of your Ptger3 antibody to test? If it works, we will likely buy a decent amount.
    • A list of our Ptger3 antibodies can be found here. It is company policy that we do not give out free samples as we have a 100% guarantee on all of our products for the applications and species listed on the datasheet. The email you received about free samples only applies to the antibodies listed in the email, of which Ptger3 is not listed.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional PTGER3 Products

Bioinformatics Tool for PTGER3 Antibody (NBP1-84835)

Discover related pathways, diseases and genes to PTGER3 Antibody (NBP1-84835). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTGER3 Antibody (NBP1-84835)

Discover more about diseases related to PTGER3 Antibody (NBP1-84835).

Pathways for PTGER3 Antibody (NBP1-84835)

View related products by pathway.

PTMs for PTGER3 Antibody (NBP1-84835)

Learn more about PTMs related to PTGER3 Antibody (NBP1-84835).

Research Areas for PTGER3 Antibody (NBP1-84835)

Find related products by research area.

Blogs on PTGER3

There are no specific blogs for PTGER3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PTGER3 Antibody and receive a gift card or discount.


Gene Symbol PTGER3