![Western Blot: PTDSS2 Antibody [NBP1-91352] - 721_B cell lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize2/PTDSS2-Antibody-Western-Blot-NBP1-91352-img0002.jpg "Western Blot: PTDSS2 Antibody [NBP1-91352] - 721_B cell lysate, concentration 0.2-1 ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Synthetic peptide directed towards the middle region of human PTDSS2. Peptide sequence QAWLVAAITATELLIVVKYDPHTLTLSLPFYISQCWTLGSVLALTWTVWR. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PTDSS2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This is a rabbit polyclonal antibody against PTDSS2 and was validated on Western blot. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
-Immunofluorescence-NBP2-37447-img0005.jpg)
-Immunohistochemistry-Paraffin-NBP2-37447-img0007.jpg)
-ELISA-NBP2-37447-img0001.jpg)
-Immunohistochemistry-NBP2-46421-img0001.jpg)
-Immunohistochemistry-NBP2-46421-img0002.jpg)
-Western-Blot-NBP2-46421-img0004.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for PTDSS2 Antibody (NBP1-91352)Discover more about diseases related to PTDSS2 Antibody (NBP1-91352).
| Pathways for PTDSS2 Antibody (NBP1-91352)View related products by pathway.
|
PTMs for PTDSS2 Antibody (NBP1-91352)Learn more about PTMs related to PTDSS2 Antibody (NBP1-91352).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry Corneodesmosin Antibody [Unconjugated]](https://images.novusbio.com/images2/Corneodesmosin_AF5725_Immunohistochemistry_7196.jpg)
-Immunohistochemistry-Paraffin-NBP2-45316-img0002.jpg)
-Flow-Cytometry-NBP2-45316-img0003.jpg)
-Immunofluorescence-NBP2-45316-img0004.jpg)
-Western-Blot-NBP2-45731-img0016.jpg)
-Immunohistochemistry-NBP2-45731-img0001.jpg)
-Immunohistochemistry-NBP2-45731-img0002.jpg)
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images2/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0001.jpg)
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images2/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0003.jpg)
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images2/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0004.jpg)
-Immunohistochemistry-Paraffin-H00008631-M01-img0003.jpg)
-Immunohistochemistry-H00008631-M01-img0004.jpg)
![Immunocytochemistry RUNX2/CBFA1 Antibody (232902) [Unconjugated]](https://images.novusbio.com/images2/RUNX2_MAB2006_Immunocytochemistry_13309.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")