PTDSS2 Antibody

Images

 
Western Blot: PTDSS2 Antibody [NBP1-91351] - 293T cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PTDSS2 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human PTDSS2. Peptide sequence GQATGPGEGRRSTESEVYDDGTNTFFWRAHTLTVLFILTCTLGYVTLLEE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTDSS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against PTDSS2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PTDSS2 Antibody

  • phosphatidylserine synthase 2
  • serine-exchange enzyme II

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83060
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00079092-T01
Species: Hu
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
AF5725
Species: Hu
Applications: WB, IHC
NBP2-61007
Species: Hu, Alp, AB, Bv, Ca, Eq, Fe, Ft, Gt, Ha, Ll, Mn, Rb, Sh, WB
Applications: Flow, Func, IHC
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-84212
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52414
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC, IF
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF4264
Species: Hu
Applications: WB
H00001325-P01
Species: Hu
NBP1-91351
Species: Hu
Applications: WB

Publications for PTDSS2 Antibody (NBP1-91351) (0)

There are no publications for PTDSS2 Antibody (NBP1-91351).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTDSS2 Antibody (NBP1-91351) (0)

There are no reviews for PTDSS2 Antibody (NBP1-91351). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PTDSS2 Antibody (NBP1-91351) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTDSS2 Products

Bioinformatics Tool for PTDSS2 Antibody (NBP1-91351)

Discover related pathways, diseases and genes to PTDSS2 Antibody (NBP1-91351). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTDSS2 Antibody (NBP1-91351)

Discover more about diseases related to PTDSS2 Antibody (NBP1-91351).
 

Pathways for PTDSS2 Antibody (NBP1-91351)

View related products by pathway.

PTMs for PTDSS2 Antibody (NBP1-91351)

Learn more about PTMs related to PTDSS2 Antibody (NBP1-91351).

Blogs on PTDSS2

There are no specific blogs for PTDSS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTDSS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTDSS2
Uniprot