PTCHD1 Antibody

Images

 
Immunohistochemistry-Paraffin: PTCHD1 Antibody [NBP2-13825] Staining of human placenta shows distinct nuclear positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PTCHD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FTGYIENNYQHSIFCRKVPKPEALQEKPAWYRFLLTARFSEDTAEGEEAN TYESHLLVCFLKRYYCDWITNT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTCHD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PTCHD1 Protein (NBP2-13825PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PTCHD1 Antibody

  • FLJ30296
  • MGC149798
  • patched domain containing 1
  • patched domain-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001806-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF4524
Species: Rt
Applications: WB
AF7035
Species: Hu
Applications: IHC
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF482
Species: Mu
Applications: WB, IHC
NBP1-87486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3075
Species: Hu
Applications: WB, ICC
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-57016
Species: Hu
Applications: WB
NBP2-33404
Species: Hu
Applications: IHC, IHC-P
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF5158
Species: Hu
Applications: WB, IHC
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-85820
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-42200
Species: Rt
Applications: WB, ICC/IF, IHC, ICC
NBP2-00873
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-27152
Species: Mu
Applications: WB

Publications for PTCHD1 Antibody (NBP2-13825) (0)

There are no publications for PTCHD1 Antibody (NBP2-13825).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTCHD1 Antibody (NBP2-13825) (0)

There are no reviews for PTCHD1 Antibody (NBP2-13825). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PTCHD1 Antibody (NBP2-13825) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTCHD1 Products

Bioinformatics Tool for PTCHD1 Antibody (NBP2-13825)

Discover related pathways, diseases and genes to PTCHD1 Antibody (NBP2-13825). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTCHD1 Antibody (NBP2-13825)

Discover more about diseases related to PTCHD1 Antibody (NBP2-13825).
 

Pathways for PTCHD1 Antibody (NBP2-13825)

View related products by pathway.

Blogs on PTCHD1

There are no specific blogs for PTCHD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTCHD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTCHD1