WDR13 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: WDR13 Antibody [NBP1-85820] - Staining of human cell line A-431 shows localization to nucleoplasm & plasma membrane.

Immunohistochemistry-Paraffin: WDR13 Antibody [NBP1-85820] - Staining of human fallopian tube shows high expression.

Immunohistochemistry-Paraffin: WDR13 Antibody [NBP1-85820] - Staining of human tonsil shows low expression as expected.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4

Immunohistochemistry analysis in human fallopian tube and tonsil tissues using Anti-WDR13 antibody. Corresponding WDR13 RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

WDR13 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GHRRSVSRGSYQLQAQMNRAVYEDRPPGSVVPTSAAEASRAMAGDTSLSENYAFAGMYHVFDQHVDEAVPRVRFANDDRHRLACCSLDGSISLCQLVPAPPTVLRVLR
• Predicted Species: Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WDR13
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 26306915). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  WDR13 Protein (NBP1-85820PEP)

Reactivity Notes

Mouse reactivity reported in the scientific literature (PMID: 26306915).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for WDR13 Antibody - BSA Free

• DKFZp779C2057
• FLJ20563
• MG21
• WD repeat domain 13
• WD repeat-containing protein 13

Background

WDR13 encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is widely expressed in various tissues, and located in chromosome X. The function of this gene has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for WDR13 Antibody (NBP1-85820)(3)

Publications using NBP1-85820

• Singh VP, Alex JL, Lakshmi BJ et al. Role of mouse Wdr13 in placental growth; a genetic evidence for lifetime body weight determination by placenta during development. Sci Rep 2015-08-26 [PMID: 26306915] (WB, Mouse)
• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]
• Singh VP, Lakshmi BJ, Singh S et al. Lack of Wdr13 gene in mice leads to enhanced pancreatic beta cell proliferation, hyperinsulinemia and mild obesity. PLoS One 2012-01-01 [PMID: 22715406]

Bioinformatics

• Gene Symbol: WDR13