PSTPIP2 Antibody

Images

 
Western Blot: PSTPIP2 Antibody [NBP2-88099] - Host: Rabbit. Target Name: Pstpip2. Sample Type: Mouse Kidney lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PSTPIP2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse PSTPIP2. Peptide sequence: SIIQHLNNGRKNCKEFEDFLKERASIEEKYGKDLLNLSRKKPCGQSEINT The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
PSTPIP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PSTPIP2 Antibody

  • MAYP
  • MGC34175
  • PEST phosphatase-interacting protein 2
  • proline-serine-threonine phosphatase interacting protein 2
  • proline-serine-threonine phosphatase-interacting protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85764
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF3756
Species: Hu, Mu, Rt
Applications: WB
MAB6460
Species: Hu
Applications: IHC, WB
NBP1-43363
Species: Mu
Applications: B/N, Flow, IHC, IHC-Fr, IHC-P, WB
NB300-996
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
7027-GT
Species: Hu
Applications: EnzAct
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF1347
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
D6050
Species: Hu
Applications: ELISA
NBP2-03227
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-37477
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
H00009322-M01
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
NBP2-94530
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
MMA00
Species: Mu
Applications: ELISA
DCP00
Species: Hu
Applications: ELISA
NBP2-88099
Species: Mu
Applications: WB

Publications for PSTPIP2 Antibody (NBP2-88099) (0)

There are no publications for PSTPIP2 Antibody (NBP2-88099).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSTPIP2 Antibody (NBP2-88099) (0)

There are no reviews for PSTPIP2 Antibody (NBP2-88099). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PSTPIP2 Antibody (NBP2-88099) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PSTPIP2 Products

Bioinformatics Tool for PSTPIP2 Antibody (NBP2-88099)

Discover related pathways, diseases and genes to PSTPIP2 Antibody (NBP2-88099). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSTPIP2 Antibody (NBP2-88099)

Discover more about diseases related to PSTPIP2 Antibody (NBP2-88099).
 

Pathways for PSTPIP2 Antibody (NBP2-88099)

View related products by pathway.

PTMs for PSTPIP2 Antibody (NBP2-88099)

Learn more about PTMs related to PSTPIP2 Antibody (NBP2-88099).
 

Research Areas for PSTPIP2 Antibody (NBP2-88099)

Find related products by research area.

Blogs on PSTPIP2

There are no specific blogs for PSTPIP2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PSTPIP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSTPIP2