PSTPIP2 Antibody - BSA Free

Western Blot: PSTPIP2 Antibody [NBP2-88099] - Host: Rabbit. Target Name: Pstpip2. Sample Type: Mouse Kidney lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PSTPIP2 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse PSTPIP2. Peptide sequence: SIIQHLNNGRKNCKEFEDFLKERASIEEKYGKDLLNLSRKKPCGQSEINT The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PSTPIP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PSTPIP2 Antibody - BSA Free

• MAYP
• MGC34175
• PEST phosphatase-interacting protein 2
• proline-serine-threonine phosphatase interacting protein 2
• proline-serine-threonine phosphatase-interacting protein 2

Background

PSTPIP2 binds to F-actin. May be involved in regulation of the actin cytoskeleton

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PSTPIP2