![Western Blot: PSPC1 Antibody [NBP2-83428] - Host: Rabbit. Target Name: PSPC1. Sample Tissue: Human Uterus Tumor lysates. Antibody Dilution: 1ug/ml](http://images.novusbio.com/fullsize/PSPC1-Antibody-Western-Blot-NBP2-83428-img0001.jpg "Western Blot: PSPC1 Antibody [NBP2-83428] - Host: Rabbit. Target Name: PSPC1. Sample Tissue: Human Uterus Tumor lysates. Antibody Dilution: 1ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human PSPC1. Peptide sequence: QMGSPMGSRTGSETPQAPMSGVGPVSGGPGGFGRGSQGGNFEGPNKRRRY The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PSPC1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Western Blot Ets-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ets-1_AF7284_Western_Blot_11854.jpg)
![Immunohistochemistry Ets-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ets1_AF7284_Immunohistochemistry_22698.jpg)
![Western Blot Syntaxin-BP3/Munc18c Antibody [Unconjugated]](https://images.novusbio.com/images2/Syntaxin-BP3_AF5659_Western_Blot_12110.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PSPC1 |
![Western Blot IGFBP-rp1/IGFBP-7 Antibody [Unconjugated]](https://images.novusbio.com/images2/IGFBPrp1_AF1334_Western_Blot_16698.jpg)
![Immunohistochemistry IGFBP-rp1/IGFBP-7 Antibody [Unconjugated]](https://images.novusbio.com/images2/IGFBPrp1_AF1334_Immunohistochemistry_17204.jpg)
![Western Blot FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Western_Blot_5399.jpg)
![Simple Western FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Simple_Western_16755.jpg)
![Immunohistochemistry FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Immunohistochemistry_6823.jpg)
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Intracellular Staining by Flow Cytometry Reg1A Antibody (431202) [Unconjugated]](https://images.novusbio.com/images2/Reg1A_MAB4937_Flow_Cytometry_8512.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
