PSMG1 Antibody - BSA Free

Western Blot: PSMG1 Antibody [NBP2-55971] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: PSMG1 Antibody [NBP2-55971] - Staining of human cell line SiHa shows localization to cytosol & the Golgi apparatus.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PSMG1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PSMG1 Antibody - BSA Free (NBP2-55971) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: THLSSTEAFCVFYHLKSNPSVFLCQCSCYVAEDQQYQWLEKVFGSCPRKNMQITILTCRHVTDYKTSESTGSLPSPF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PSMG1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PSMG1 Recombinant Protein Antigen (NBP2-55971PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PSMG1 Antibody - BSA Free

• C21-LRP
• C21LRPc21-LRP
• Chromosome 21 leucine-rich protein
• Down syndrome critical region gene 2
• DSCR2leucine rich protein C21-LRP
• LRPC21
• PAC-1
• PAC1Down syndrome critical region protein 2
• proteasome (prosome, macropain) assembly chaperone 1
• proteasome assembling chaperone 1
• proteasome assembly chaperone 1

Background

Chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG2. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PSMG1