PSMG1 Antibody - BSA Free

Western Blot: PSMG1 Antibody [NBP1-52843] - Human heart lysate, recommended antibody concentration 0.2 - 1 ug/mL.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PSMG1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to PSMG1(proteasome (prosome, macropain) assembly chaperone 1) The peptide sequence was selected from the middle region of PSMG1. Peptide sequence VMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PSMG1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PSMG1 Antibody - BSA Free

• C21-LRP
• C21LRPc21-LRP
• Chromosome 21 leucine-rich protein
• Down syndrome critical region gene 2
• DSCR2leucine rich protein C21-LRP
• LRPC21
• PAC-1
• PAC1Down syndrome critical region protein 2
• proteasome (prosome, macropain) assembly chaperone 1
• proteasome assembling chaperone 1
• proteasome assembly chaperone 1

Background

PSMG1 is a chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG2. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PSMG1
• Uniprot:
  • O95456(Human)