PSMG1 Antibody

Images

 
Western Blot: PSMG1 Antibody [NBP1-52843] - Human Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PSMG1 Antibody Summary

Immunogen
Synthetic peptides corresponding to PSMG1(proteasome (prosome, macropain) assembly chaperone 1) The peptide sequence was selected from the middle region of PSMG1. Peptide sequence VMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSMG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PSMG1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PSMG1 Antibody

  • C21-LRP
  • C21LRPc21-LRP
  • Chromosome 21 leucine-rich protein
  • Down syndrome critical region gene 2
  • DSCR2leucine rich protein C21-LRP
  • LRPC21
  • PAC-1
  • PAC1Down syndrome critical region protein 2
  • proteasome (prosome, macropain) assembly chaperone 1
  • proteasome assembling chaperone 1
  • proteasome assembly chaperone 1

Background

PSMG1 is a chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG2. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6380
Species: Mu
Applications: WB
NBP1-31619
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-14934
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-89640
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB5416
Species: Hu
Applications: IHC
NLS948
Species: Hu, Bt, Ca, Ch, Mk, Pm, Xp
Applications: IHC, IHC-P
NBP2-42225
Species: Hu, Ca
Applications: WB, DB, EM, ELISA, Flow, Func, ICC/IF, IP
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-81858
Species: Hu
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-834
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
NBP1-52843
Species: Hu
Applications: WB

Publications for PSMG1 Antibody (NBP1-52843) (0)

There are no publications for PSMG1 Antibody (NBP1-52843).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSMG1 Antibody (NBP1-52843) (0)

There are no reviews for PSMG1 Antibody (NBP1-52843). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PSMG1 Antibody (NBP1-52843) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PSMG1 Products

Bioinformatics Tool for PSMG1 Antibody (NBP1-52843)

Discover related pathways, diseases and genes to PSMG1 Antibody (NBP1-52843). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSMG1 Antibody (NBP1-52843)

Discover more about diseases related to PSMG1 Antibody (NBP1-52843).
 

Pathways for PSMG1 Antibody (NBP1-52843)

View related products by pathway.

PTMs for PSMG1 Antibody (NBP1-52843)

Learn more about PTMs related to PSMG1 Antibody (NBP1-52843).

Blogs on PSMG1

There are no specific blogs for PSMG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PSMG1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMG1
Uniprot