![Western Blot: PSMD14 Antibody [H00010213-B02P] - Analysis of PSMD14 expression in transfected 293T cell line by PSMD14 polyclonal antibody. Lane 1: PSMD14 transfected lysate(34.1 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/PSMD14-Antibody-Western-Blot-H00010213-B02P-img0002.jpg "Western Blot: PSMD14 Antibody [H00010213-B02P] - Analysis of PSMD14 expression in transfected 293T cell line by PSMD14 polyclonal antibody. Lane 1: PSMD14 transfected lysate(34.1 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | PSMD14 (NP_005796.1, 1 a.a. - 310 a.a.) full-length human protein. MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | PSMD14 |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This antibody is useful for Western Blot, Functional, Immunofluorescence |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
![Immunocytochemistry FosB/G0S3 Antibody [Unconjugated]](https://images.novusbio.com/images2/FosB_AF2214_Immunocytochemistry__Immunofluorescence_21634.jpg)
![Immunohistochemistry FosB/G0S3 Antibody [Unconjugated]](https://images.novusbio.com/images2/FosB_AF2214_Immunohistochemistry_9938.jpg)
![Western Blot AMSH/STAMBP Antibody [Unconjugated]](https://images.novusbio.com/images2/AMSH_AF5650_Western_Blot_5795.jpg)
![Immunohistochemistry AMSH/STAMBP Antibody [Unconjugated]](https://images.novusbio.com/images2/AMSH_AF5650_Immunohistochemistry_19609.jpg)
![Marapsin/Pancreasin Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Marapsin/Pancreasin Antibody [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
Research Areas for PSMD14 Antibody (H00010213-B02P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PSMD14 |
| Uniprot |
|
![Immunocytochemistry/Immunofluorescence: PSMD14 Antibody [H00010213-B02P] - Analysis of purified antibody to PSMD14 on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/fullsize/PSMD14-Antibody-Immunocytochemistry-Immunofluorescence-H00010213-B02P-img0001.jpg "Immunocytochemistry/Immunofluorescence: PSMD14 Antibody [H00010213-B02P] - Analysis of purified antibody to PSMD14 on HeLa cell. (antibody concentration 10 ug/ml)")
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")