PSMC6 Antibody

Images

 
Western Blot: PSMC6 Antibody [NBP2-13822] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: PSMC6 Antibody [NBP2-13822] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: PSMC6 Antibody [NBP2-13822] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PSMC6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLT IMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSMC6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
PSMC6 Protein (NBP2-13822PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PSMC6 Antibody

  • 26S protease regulatory subunit 10B
  • 26S protease regulatory subunit S10B
  • 26S proteasome AAA-ATPase subunit RPT4
  • CADP44
  • conserved ATPase domain protein 44
  • MGC12520
  • p42
  • P44
  • proteasome (prosome, macropain) 26S subunit, ATPase, 6
  • Proteasome 26S subunit ATPase 6
  • Proteasome subunit p42
  • SUG2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC

Publications for PSMC6 Antibody (NBP2-13822) (0)

There are no publications for PSMC6 Antibody (NBP2-13822).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSMC6 Antibody (NBP2-13822) (0)

There are no reviews for PSMC6 Antibody (NBP2-13822). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PSMC6 Antibody (NBP2-13822) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PSMC6 Products

Bioinformatics Tool for PSMC6 Antibody (NBP2-13822)

Discover related pathways, diseases and genes to PSMC6 Antibody (NBP2-13822). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSMC6 Antibody (NBP2-13822)

Discover more about diseases related to PSMC6 Antibody (NBP2-13822).
 

Pathways for PSMC6 Antibody (NBP2-13822)

View related products by pathway.

Blogs on PSMC6

There are no specific blogs for PSMC6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PSMC6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMC6