We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PSMA/FOLH1/NAALADase I Recombinant Protein Antigen

Images

 
There are currently no images for PSMA/FOLH1/NAALADase I Protein (NBP1-89822PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PSMA/FOLH1/NAALADase I Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FOLH1.

Source: E. coli

Amino Acid Sequence: ADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FOLH1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89822.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PSMA/FOLH1/NAALADase I Recombinant Protein Antigen

  • Cell growth-inhibiting gene 27 protein
  • cell growth-inhibiting protein 27
  • EC 3.4.17.21
  • FGCP
  • folate hydrolase (prostate-specific membrane antigen) 1
  • Folate hydrolase 1
  • FOLH1
  • FOLHNAALADase I
  • Folylpoly-gamma-glutamate carboxypeptidase
  • GCP2
  • GCPII
  • GCPIImGCP
  • glutamate carboxylase II
  • glutamate carboxypeptidase 2
  • Glutamate carboxypeptidase II
  • Membrane glutamate carboxypeptidase
  • mopsm
  • NAALAD1
  • NAALAD1N-acetylated-alpha-linked acidic dipeptidase I
  • NAALADase I
  • NAALAdase
  • N-acetylated alpha-linked acidic dipeptidase 1
  • prostate specific membrane antigen variant F
  • Prostate-specific membrane antigen
  • PSMA
  • PSMAFGCP
  • PSMPteroylpoly-gamma-glutamate carboxypeptidase

Background

PSMA, also known as Glutamate carboxypeptidase 2, is a 84kDa 750 amino acid protein that has 8 isoforms produced by alternative splicing. The primary function of this protein is to act as a glutamate carboxypeptidase. Current research on PSMA is being conducted in relation to prostate cancer, muscular atrophy, small cell carcinoma, coronary heart disease and Huntington's disease. PSMA is known to interact with MME, MTAP and RPS3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DKK300
Species: Hu
Applications: ELISA
NBP1-32920
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
AF4036
Species: Hu
Applications: Simple Western, WB
H00005324-M02
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB
NBP3-48658
Species: Ca, Fe, Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
NBP3-17040
Species: Hu
Applications: IHC,  IHC-P, WB
NLS3208
Species: Bv, Eq, Hu, Pm, Po, Pm
Applications: ICC, IHC,  IHC-P, WB
NBP2-22321
Species: Hu
Applications: ICC/IF, IP, WB
NB110-74730
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP1-59904
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-21421
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-83224
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00005122-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB

Publications for PSMA/FOLH1/NAALADase I Protein (NBP1-89822PEP) (0)

There are no publications for PSMA/FOLH1/NAALADase I Protein (NBP1-89822PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSMA/FOLH1/NAALADase I Protein (NBP1-89822PEP) (0)

There are no reviews for PSMA/FOLH1/NAALADase I Protein (NBP1-89822PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PSMA/FOLH1/NAALADase I Protein (NBP1-89822PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PSMA/FOLH1/NAALADase I Products

Research Areas for PSMA/FOLH1/NAALADase I Protein (NBP1-89822PEP)

Find related products by research area.

Blogs on PSMA/FOLH1/NAALADase I.

Taking Biomarker Discovery From 2D to 3D: Increased Biological Activity of EVs Isolated From 3D Prostate Cancer Cultures
Jamshed Arslan, Pharm D, PhD Tissues within the human body are made of a three-dimensional (3D) arrangement of cells working together to perform vital functions. The commonly used 2D monolayer cultures have limited ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PSMA/FOLH1/NAALADase I Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FOLH1