PSF1 Recombinant Protein Antigen

Images

 
There are currently no images for PSF1 Recombinant Protein Antigen (NBP2-30619PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PSF1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GINS1.

Source: E.coli

Amino Acid Sequence: HMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEH

Protein/Peptide Type
Recombinant Protein Antigen
Gene
GINS1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-30619. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PSF1 Recombinant Protein Antigen

  • GINS complex subunit 1 (Psf1 homolog)
  • GINS complex subunit 1
  • KIAA0186PSF1DNA replication complex GINS protein PSF1
  • partner of sld five-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33825
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16659
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92300
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54435
Species: Hu
Applications: WB, Flow, IP
NBP2-67897
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-31769
Species: Hu
Applications: IHC, IHC-P
NBP2-41181
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF
NBP2-46403
Species: Hu
Applications: IHC
NBP1-87423
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
H00057804-M01A
Species: Hu
Applications: WB, ELISA
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-13920
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92102
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
H00004172-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO

Publications for PSF1 Recombinant Protein Antigen (NBP2-30619PEP) (0)

There are no publications for PSF1 Recombinant Protein Antigen (NBP2-30619PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSF1 Recombinant Protein Antigen (NBP2-30619PEP) (0)

There are no reviews for PSF1 Recombinant Protein Antigen (NBP2-30619PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for PSF1 Recombinant Protein Antigen (NBP2-30619PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for PSF1 Recombinant Protein Antigen (NBP2-30619PEP)

Discover related pathways, diseases and genes to PSF1 Recombinant Protein Antigen (NBP2-30619PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSF1 Recombinant Protein Antigen (NBP2-30619PEP)

Discover more about diseases related to PSF1 Recombinant Protein Antigen (NBP2-30619PEP).
 

Pathways for PSF1 Recombinant Protein Antigen (NBP2-30619PEP)

View related products by pathway.

PTMs for PSF1 Recombinant Protein Antigen (NBP2-30619PEP)

Learn more about PTMs related to PSF1 Recombinant Protein Antigen (NBP2-30619PEP).
 

Research Areas for PSF1 Recombinant Protein Antigen (NBP2-30619PEP)

Find related products by research area.

Blogs on PSF1

There are no specific blogs for PSF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PSF1 Antibody
H00009837-B02P

Contact Information

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PSF1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GINS1