New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

PRSS16 Antibody

Images

 
Western Blot: PRSS16 Antibody [NBP2-85546] - Host: Rabbit. Target Name: TSSP. Sample Type: Ovary Tumor lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRSS16 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TSSP. Peptide sequence: QDGPIFLHLGGEGSLGPGSVMRGHPAALAPAWGALVISLEHRFYGLSIPA The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
PRSS16
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRSS16 Antibody

  • FLJ36271
  • FLJ44172
  • protease, serine, 16 (thymus)
  • thymus specific serine peptidase
  • thymus-specific serine protease

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-61118
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
H00000826-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, PLA, S-ELISA, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
NBP2-46290
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-45316
Species: Hu, Pm
Applications: Flow, ICC/IF, IF, IHC, IHC-P, WB
NB100-56565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-67333
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-33380
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF1180
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP1-86022
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF1183
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, Neut, WB
AF952
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NBP2-16851
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NB100-1780
Species: Hu, Mu
Applications: Flow, PEP-ELISA, WB
NBP1-87850
Species: Hu
Applications: IHC, IHC-P
NBP2-85546
Species: Hu
Applications: WB

Publications for PRSS16 Antibody (NBP2-85546) (0)

There are no publications for PRSS16 Antibody (NBP2-85546).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRSS16 Antibody (NBP2-85546) (0)

There are no reviews for PRSS16 Antibody (NBP2-85546). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRSS16 Antibody (NBP2-85546) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRSS16 Products

Bioinformatics Tool for PRSS16 Antibody (NBP2-85546)

Discover related pathways, diseases and genes to PRSS16 Antibody (NBP2-85546). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRSS16 Antibody (NBP2-85546)

Discover more about diseases related to PRSS16 Antibody (NBP2-85546).
 

Pathways for PRSS16 Antibody (NBP2-85546)

View related products by pathway.

Blogs on PRSS16

There are no specific blogs for PRSS16, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRSS16 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRSS16