We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PRRX1 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related PRRX1 Peptides and Proteins

Order Details


    • Catalog Number
      NBP2-13816PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PRRX1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRRX1.

Source: E. coli

Amino Acid Sequence: LDLEEAGDMVAAQADENVGEAGRSLLESPGLTSGSDTPQQDNDQLNSEEKKKRKQRRNR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRRX1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13816.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PRRX1 Recombinant Protein Antigen

  • Homeobox protein PHOX1
  • paired mesoderm homeo box 1
  • paired mesoderm homeobox 1 isoform pmx-1b
  • paired mesoderm homeobox protein 1
  • paired related homeobox 1
  • Paired-related homeobox protein 1
  • PHOX1PRX-1
  • PMX1PRX1

Background

The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription co-activator, enhancing the DNA-binding activity of serum response factor, a protein required for the induction of genes by growth and differentiation factors. The protein regulates muscle creatine kinase, indicating a role in the establishment of diverse mesodermal muscle types. Alternative splicing yields two isoforms that differ in abundance and expression patterns.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80893
Species: Hu
Applications: ChIP-EXO-SEQ, IHC,  IHC-P
NBP1-82558
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF3489
Species: Hu, Mu, Rt
Applications: Simple Western, WB
H00009588-M01
Species: Bv, Hu
Applications: DB, ELISA, WB
NBP3-13785
Species: Hu
Applications: ELISA, Flow, ICC/IF,  IHC-P, IP, PA, WB
NBP2-52983
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB110-68136
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP3-32740
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP3-27806
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IP, WB
NBP1-87372
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-19777
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KO, WB
423-F8
Species: Hu, Mu
Applications: BA
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
314-BP
Species: Hu
Applications: BA, BA

Publications for PRRX1 Protein (NBP2-13816PEP) (0)

There are no publications for PRRX1 Protein (NBP2-13816PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRRX1 Protein (NBP2-13816PEP) (0)

There are no reviews for PRRX1 Protein (NBP2-13816PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PRRX1 Protein (NBP2-13816PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PRRX1 Products

Research Areas for PRRX1 Protein (NBP2-13816PEP)

Find related products by research area.

Blogs on PRRX1

There are no specific blogs for PRRX1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PRRX1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PRRX1