PRRT2 Antibody (CL4233)

Images

 
Immunohistochemistry-Paraffin: PRRT2 Antibody [NBP2-59042] - Staining of human tonsil shows no positivity as expected (negative control).
Immunohistochemistry-Paraffin: PRRT2 Antibody [NBP2-59042] - Staining of human cerebral cortex shows strong immunoreactivity in neuropil.
Immunohistochemistry-Paraffin: PRRT2 Antibody [NBP2-59042] - Staining of human cerebellum shows strong positivity in neuropil.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clone
CL4233
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PRRT2 Antibody (CL4233) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PKPALQPELPTQEDPTPEILSESVGEKQENGAVVPLQAGDGEEGPAPEPHSPPSKKSPPANGAPPRVLQQLVEEDRMRRAHSGHPGSPRGSLSRHPSSQLAGPGVEGGEGTQKPRDY
Specificity
Specificity of human PRRT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
PRRT2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PRRT2 Recombinant Protein Antigen (NBP2-59042PEP)

Reactivity Notes

Expected to cross react based on sequence identity: Mouse (88%), Rat (87%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for PRRT2 Antibody (CL4233)

  • DKFZp547J199
  • FLJ25513
  • IFITMD1
  • interferon induced transmembrane protein domain containing 1
  • proline-rich transmembrane protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB600-201
Species: Hu, Mu, Rt, Po, Bv, Ca, Fi, Rb, Sh
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, RIA
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF2364
Species: Hu
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-66296
Species: Hu
NBP1-98474
Species: Hu
Applications: WB
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP2-59042
Species: Hu
Applications: IHC, IHC-P

Publications for PRRT2 Antibody (NBP2-59042) (0)

There are no publications for PRRT2 Antibody (NBP2-59042).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRRT2 Antibody (NBP2-59042) (0)

There are no reviews for PRRT2 Antibody (NBP2-59042). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PRRT2 Antibody (NBP2-59042) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PRRT2 Antibody (NBP2-59042)

Discover related pathways, diseases and genes to PRRT2 Antibody (NBP2-59042). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRRT2 Antibody (NBP2-59042)

Discover more about diseases related to PRRT2 Antibody (NBP2-59042).
 

Pathways for PRRT2 Antibody (NBP2-59042)

View related products by pathway.

Blogs on PRRT2

There are no specific blogs for PRRT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRRT2 Antibody (CL4233) and receive a gift card or discount.

Bioinformatics

Gene Symbol PRRT2