Recombinant Human PRR7 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PRR7 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-274 of Human PRR7 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MVMSQGTYTFLTCFAGFWLIWGLIVLLCCFCSFLRRRLKRRQEERLREQNLRALELEPLELEGSLAGSPPGLAPPQPPPHRSRLEAPAHAHSHPHVHVHPLLHHGPAQPHAHAHPHPHHHALPHPPPTHLSVPPRPWSYPRQAESDMSKPPCYEEAVLMAEPPPPYSEVLTDTRGLYRKIVTPFLSRRDSAEKQEQPPPSYKPLFLDRGYTSALHLPSAPRPAPPCPALCLQADRGRRVFPSWTDSELSSREPLEHGAWRLPVSIPLFGRTTAV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
PRR7
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PRR7 Protein

  • MGC10772
  • proline rich 7 (synaptic)
  • proline-rich protein 7
  • Synaptic proline-rich membrane protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91041
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01198
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5309
Species: Hu
Applications: WB
NBP1-86589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-55986
Species: Hu
Applications: ICC/IF
AF3064
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-52926
Species: Hu
Applications: WB
NBP2-13954
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84212
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5489
Species: Hu
Applications: WB, IHC
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-15083
Species: Hu, Rt
Applications: WB, IHC, IHC-P
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NBP1-88169
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, ISH
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88523
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00080758-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for PRR7 Recombinant Protein (H00080758-P01) (0)

There are no publications for PRR7 Recombinant Protein (H00080758-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRR7 Recombinant Protein (H00080758-P01) (0)

There are no reviews for PRR7 Recombinant Protein (H00080758-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRR7 Recombinant Protein (H00080758-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PRR7 Products

PRR7 H00080758-P01

Bioinformatics Tool for PRR7 Recombinant Protein (H00080758-P01)

Discover related pathways, diseases and genes to PRR7 Recombinant Protein (H00080758-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRR7 Recombinant Protein (H00080758-P01)

Discover more about diseases related to PRR7 Recombinant Protein (H00080758-P01).
 

Pathways for PRR7 Recombinant Protein (H00080758-P01)

View related products by pathway.

PTMs for PRR7 Recombinant Protein (H00080758-P01)

Learn more about PTMs related to PRR7 Recombinant Protein (H00080758-P01).

Blogs on PRR7

There are no specific blogs for PRR7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-2 [Unconjugated]
202-IL-010/CF
PRR7 Antibody
NBP2-13815

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PRR7 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PRR7